close all open/close all

CDS information : Kirro_00460


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction103,763 / 103,254 / - [in whole cluster]
103,763 / 103,254 / - [in contig]
Locationcomplement(103254..103763) [in whole cluster]
complement(103254..103763) [in contig]
TypeCDS
Length510 bp (169 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acetyltransferase
Product (GenBank)putative GNAT family acetyltransferase
Gene
Gene (GenBank)kirE
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)
Family/Domain
FD
IPR000182

close this sectionSequence

selected fasta
>putative acetyltransferase [putative GNAT family acetyltransferase]
MPDVSVRLANTADRPVVERLWLMFRHDMSELGNLLPNADGTFRSDRLHMAFSEPDWAPYL
LTSGDRPAGFAFVRGLTAPTRVLNSFFVVRGARRTGIGLHAVQEIAARHPGSWEVAFQDA
NIAAVHFWRRVATEISDDAWTEERRPIPGRPELPPDVWISFNAPGETDG
selected fasta
>putative acetyltransferase [putative GNAT family acetyltransferase]
GTGCCAGACGTATCCGTTCGTCTCGCGAACACCGCCGACCGCCCCGTGGTGGAGCGGCTC
TGGCTGATGTTCCGCCATGACATGTCGGAGTTGGGCAATCTGCTGCCGAACGCTGACGGA
ACCTTCCGCAGCGACCGGCTCCACATGGCCTTCTCCGAGCCCGACTGGGCGCCGTACCTC
CTCACAAGCGGTGACCGACCGGCCGGCTTCGCGTTCGTCCGCGGTCTGACCGCCCCGACA
CGGGTGCTGAACAGCTTCTTCGTGGTGCGTGGTGCACGGCGGACAGGGATCGGGCTGCAC
GCTGTTCAGGAGATCGCGGCCAGACACCCAGGCTCGTGGGAAGTCGCGTTCCAGGATGCC
AACATCGCCGCTGTGCACTTCTGGCGTCGCGTCGCCACGGAGATCTCCGACGACGCGTGG
ACCGAGGAACGCCGACCGATCCCAGGGCGGCCCGAACTGCCTCCTGATGTCTGGATCTCG
TTCAACGCCCCTGGGGAGACGGACGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [18-164]  PS51186
PS51186   GNAT
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [1-130]  4.5e-07 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
 [3-130]  2.19999900980708e-10 SSF55729
SSF55729   Acyl_CoA_acyltransferase
SignalP No significant hit
TMHMM No significant hit