close all open/close all

CDS information : Kirro_00470


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction105,617 / 113,008 / + [in whole cluster]
105,617 / 113,008 / + [in contig]
Location105617..113008 [in whole cluster]
105617..113008 [in contig]
TypeCDS
Length7,392 bp (2,463 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)putative non-ribosomal peptide synthetase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in Kirromycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase]
MATHVSVAPVVPGEPFTTSSAEPPVDVFRASRAQQRMYFLQELQGGMPTYHMPVFCAFDA
DVDVEVELLRACAQRLVDRHEALRTRFVLADGELTQCVDASARLDWSVETADGAGDGAVR
RWMEAQYRRPFDLAAGPLFRAALLRRPEGAVLALGMHHIVGDGWSAGILLREMLEDYAAA
TDESGAPVRVGEPEFQYADFSEWQEEWLRGPAAERQLAYWAEQLGGELPTCGIPADHRPA
VGSASHALAPRTAATHEVPLPDAVLQRLDQVCRDTGSTRFMALLAAFQVVLGRWSGSEDV
LVGTPVAGRNRTQFADTVGLFVNTLVIRSDLTADPGFRDHVAAVRDTVADAQDHQDLPFE
RIVEHLNPGRTTDRAPFFDVLFGFHDEDDTTAGLPGPRVRLLEGPTAAAKFDLTFDVVRS
RGGLHLRLEYRADLYEAATIERFTGHYLRLLDAAVSAPQLPLSALPMLSDAEQLPLTSPR
PATAAQAPERCAHEIFAEHAGRTPDAVAVTDGTRQLCYGDLDRRANQVAHRLRALGVGPG
TLVGLCVPRSAELVVGLLGILKAGGAYLPLDPDSPPERLHHIVGDAGLAHVVGTTGTRPL
WDVSGLRAVDLEADADGLDRLPATAPRSGVTPDDLAYVIYTSGSTGRPKGTLVPHRNITR
LFSATDHWFGFGADDVWTLFHSIAFDFSVWELWGALAHGGRLVVVPYVTSRSPQEFHRLL
CEERVTVLNQTPSAFHQFDRADELSPRQDRLALRQVVFGGEALDVAALRGWFRRHGDTAP
RLVNMYGITETTVHVTYRPLTARDAEEGRGSVIGVPIPDLRLHLLDDRGRAVPHGAVGEL
YVAGAGLARGYLNRARLTAERFPTTASGERRYRTGDLARLRADGELEYLGRIDDQVKLRG
FRIELGEIEAALTAHAGVRAAVARVVRDATGSPVLTGYVVPAPHTGADGTGPLSVDDLRA
HLAARLPDYMIPGAFLTVPALPLTGNGKVDRRALPAPGTEGAVALGSAAAHEPVSGPVET
ALAEIWQEVLGHPRIGALDNYFALGGDSIRSLQVLARARDRGLRFTVADLMRHQTVRGLA
GAVDAEPDAPADPPSYRPFSLLGDADRAALPQGLEDAYPMTRLQAGMLFHSDLPAGTGRV
YHNVGSYHIQAPWSEDAWRRTVAEAGARHEMLRTSFDPHGFGEPLQLVHRDARPRITFED
LRERDAAGRQAAVAARYEAERANPFAWDEAPLIRFHVQRRTDTAFQLFIAEHHAVMDGWS
ERSLLTELLSRYVELCAPGDGAAPSAPAPRSRFASFVALERDALADPAARAFWDEVTQDA
PVTRLPRSATTGGAPRMTWHHAPLPGGLHERLSALAAALGVPLRTVLLAAHTRVMALMGG
ADEITTGVVVNGRTEEADGDKVVGAFLNTLPCRLTVTRESWRDLVRRVAELELRAHEHRR
YPLAEIVRRNGGTAPFETFFNYTHFHVEHDGPSAGTFTVLEETGEAATDMAFGAEFSRTP
DGRALELGLRYDAARFTAERMAALHDSYTAALRALADTPDLDCTEADLVPPQDHRRHAVW
NDTARHYDAPHTLTGLIERQVRRTPDAPAVRFEGTALGYRQLDEAAERLAARLRALGARP
GAFVGLLMDRSLLLPVALLAVLKSGAAYVPLDPDHPEARTRALLSQAGIGLVVADGRRAG
ALRAAGPADAPTVTVVVPDEPGPAADSAAVPVTAAGPDDPAYMIFTSGSTGTPKGVVVAH
RAIANRLLWMQEAYGLNPGERVLQKTPYTFDVSVWEFFWPLLTGGVLVLARPGGQRDPAY
LAGLVAEEGVSTVHFVPSMLDVFLDDPLAVRRAAGLTRVLCSGEALPHEVQTRFLDLLPH
VELHNLYGPTEAAVDVTAWHCLPGAGDTVPIGRPIANMRTHVLDARLREVPTGVTGELFL
EGVGLALGYHGRPDLTAERFVQLTGADGVTRRLYRTGDLARHRTDGALEYAGRTDHQMKI
RGFRVEPGEIEAALAEHPEVRACAVLLHGERLTGYVVPTGDTGDTADIGGTGGTAADEAA
AGAALDTYARTRLPRHMVPSAWVLLDALPLTRNGKLDRAALPAPDPAHAVRRTPSRPPRG
ATETRLAGLWEQILRTGPVGADDDFFAAGGHSIDALRLIGRINEAFGERLSVATVMEHPT
VARQAQALRARRRSGTADTVVRIRPDGDLDPLVLVHPVGGNVLCYRSLATALRPGRPVYG
LSAPGLTTAAPDGAGDAGVQELAAVHVAALRTVRPHGPYHLAGWSLGGLLAYEMAHQLRA
DGEEVATLTLLDTAYPGTTDVPADGIALLEWFHDDLARSAGADPGAAARDALRAALEAAD
GTPAQLRAVAAALAVDGRVPALDTAALARHHAVFRTGLLAASRYRPPVASGTVHFHQSTT
GAALHSADRWATRVPDGLVRHDSDADHYALVRAPHVRAVAAALDAALDAALGPAARPDGH
RVR
selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase]
TTGGCCACTCACGTTTCGGTCGCCCCGGTGGTTCCGGGAGAACCGTTCACCACGTCATCC
GCAGAGCCACCCGTCGATGTCTTCCGGGCCTCCCGGGCGCAGCAGCGGATGTATTTCCTC
CAGGAGTTGCAGGGCGGCATGCCCACTTATCACATGCCGGTCTTCTGCGCGTTCGACGCG
GACGTCGACGTCGAGGTGGAGCTGCTGCGGGCCTGCGCCCAGCGGCTGGTCGACCGGCAC
GAGGCGCTGCGCACCCGGTTCGTGCTGGCGGACGGCGAGCTGACGCAGTGCGTCGACGCC
TCCGCGCGGCTCGACTGGTCGGTGGAGACGGCGGACGGCGCCGGCGACGGCGCCGTGCGG
CGCTGGATGGAGGCCCAGTACCGGCGGCCCTTCGACCTCGCCGCCGGCCCGCTGTTCCGG
GCCGCCCTGCTGCGCCGCCCCGAAGGCGCCGTGCTGGCGCTCGGAATGCACCACATCGTC
GGTGACGGATGGTCCGCGGGAATTCTGCTGCGGGAAATGCTGGAGGACTACGCCGCCGCC
ACGGACGAATCCGGGGCGCCGGTTCGGGTCGGAGAGCCGGAATTCCAGTACGCCGATTTC
TCCGAATGGCAGGAGGAATGGCTGCGCGGTCCCGCCGCCGAGCGACAGCTCGCCTACTGG
GCGGAACAGCTGGGCGGCGAACTGCCGACCTGCGGGATCCCCGCCGACCACCGCCCGGCC
GTCGGGTCCGCCTCCCACGCCCTCGCCCCCCGCACCGCCGCCACGCACGAAGTCCCGTTG
CCCGACGCCGTGCTGCAACGGCTCGACCAGGTCTGCCGGGACACCGGCAGCACCCGCTTC
ATGGCGCTGCTCGCCGCCTTCCAGGTGGTGCTCGGCCGCTGGTCCGGCAGTGAGGACGTC
CTCGTCGGCACCCCCGTCGCAGGTCGCAACCGCACACAGTTCGCCGACACGGTCGGTCTG
TTCGTCAACACCCTCGTGATTCGCTCGGACCTGACCGCGGACCCCGGCTTCCGCGATCAC
GTGGCCGCCGTGCGGGACACCGTCGCGGACGCTCAGGACCACCAGGACCTGCCCTTCGAG
CGGATCGTCGAACACCTCAACCCCGGACGCACCACGGACCGGGCCCCGTTCTTCGACGTG
CTCTTCGGCTTCCACGACGAGGACGACACCACGGCCGGGCTGCCAGGCCCCCGCGTCCGC
CTGCTGGAAGGCCCCACCGCCGCCGCGAAGTTCGACCTGACCTTCGATGTCGTGCGGTCG
CGCGGCGGCCTGCACCTGCGTCTGGAGTACCGGGCCGACCTCTACGAAGCCGCGACCATC
GAGCGGTTCACCGGGCACTATCTGCGGCTGCTGGACGCCGCCGTCAGCGCCCCGCAGCTG
CCCCTGTCCGCGCTCCCGATGCTCTCGGACGCCGAACAACTGCCCCTGACCTCCCCGCGG
CCCGCCACCGCCGCGCAGGCTCCCGAGCGCTGCGCCCACGAGATCTTCGCCGAGCACGCC
GGCCGGACACCCGACGCGGTGGCCGTCACCGACGGCACCCGTCAGCTGTGCTACGGCGAC
CTCGACCGCCGAGCCAACCAGGTGGCCCACCGCCTGCGCGCCCTCGGCGTCGGCCCCGGC
ACCCTCGTCGGCCTGTGCGTACCCCGGTCCGCCGAACTCGTCGTCGGCCTGCTGGGCATC
CTCAAAGCAGGGGGCGCGTACCTGCCGCTCGACCCGGACAGCCCGCCGGAGCGGCTGCAC
CACATAGTCGGCGACGCCGGCCTCGCGCACGTCGTCGGCACCACCGGCACCCGCCCGCTG
TGGGACGTTTCCGGCCTGCGCGCCGTCGATCTGGAGGCCGACGCGGACGGGCTGGACCGG
CTGCCCGCGACGGCCCCCCGCAGCGGGGTCACCCCCGACGACCTCGCCTACGTCATCTAC
ACCTCCGGCTCCACGGGACGCCCCAAGGGCACCCTGGTGCCGCACCGCAACATCACCCGT
CTGTTCTCCGCCACGGACCACTGGTTCGGGTTCGGCGCCGACGACGTGTGGACCCTCTTC
CACTCCATCGCCTTCGACTTCTCCGTGTGGGAACTGTGGGGCGCCCTGGCCCACGGCGGC
CGGCTCGTCGTCGTGCCGTACGTCACGAGCCGTTCCCCGCAGGAGTTCCACCGGCTGCTG
TGCGAGGAGCGGGTCACCGTCCTCAACCAGACGCCGTCCGCCTTCCACCAGTTCGACCGC
GCCGACGAGCTGAGCCCGCGGCAGGACCGGCTCGCGCTGCGGCAGGTGGTGTTCGGCGGC
GAGGCCCTGGACGTCGCCGCCCTGCGCGGCTGGTTCCGGCGGCACGGCGACACCGCGCCC
CGCCTGGTGAACATGTACGGCATCACCGAGACCACCGTGCACGTCACCTACCGCCCCCTG
ACCGCGCGCGACGCCGAGGAGGGCCGCGGCAGCGTCATCGGCGTGCCCATTCCCGACCTG
CGGCTGCACCTGCTGGACGACCGCGGCAGAGCGGTGCCTCACGGAGCCGTGGGCGAGCTG
TACGTCGCCGGGGCGGGCCTCGCCCGTGGCTACCTCAACCGCGCCCGGCTGACCGCCGAA
CGCTTCCCCACGACGGCCTCGGGGGAGCGGCGCTACCGGACCGGGGACCTCGCCCGGCTG
CGCGCGGACGGTGAACTGGAGTACCTGGGCCGCATCGACGACCAGGTCAAGCTGCGCGGT
TTCCGCATCGAGCTGGGCGAGATCGAGGCGGCCCTCACCGCCCACGCCGGGGTCCGCGCC
GCCGTGGCCCGTGTCGTCCGCGACGCCACCGGGAGCCCGGTCCTGACCGGGTACGTCGTA
CCGGCCCCGCACACCGGGGCGGACGGCACCGGCCCGCTCAGCGTCGACGACCTGCGCGCG
CACCTCGCCGCGCGGCTGCCCGACTACATGATCCCCGGCGCCTTCCTCACCGTCCCCGCC
TTGCCGCTCACCGGCAACGGCAAGGTCGACCGGCGCGCCCTGCCGGCACCGGGTACCGAG
GGAGCGGTCGCGCTGGGGTCGGCGGCGGCGCACGAACCGGTGAGCGGCCCGGTCGAGACG
GCCCTCGCCGAGATCTGGCAGGAGGTCCTCGGACACCCGCGGATCGGCGCGCTCGACAAC
TACTTCGCCCTCGGCGGCGACTCCATCCGGTCGCTGCAGGTGCTCGCCCGCGCCCGCGAC
CGCGGACTGCGCTTCACCGTGGCCGACCTGATGCGGCACCAGACGGTGCGCGGGCTCGCC
GGGGCTGTCGACGCGGAGCCGGACGCACCGGCCGACCCGCCGTCGTACCGGCCCTTCTCC
CTGCTGGGCGACGCCGACCGGGCCGCCCTGCCGCAGGGACTGGAAGACGCCTACCCGATG
ACCCGGCTCCAGGCCGGGATGCTCTTCCACAGCGATCTGCCCGCCGGTACCGGCCGCGTC
TACCACAACGTCGGCTCGTACCACATCCAGGCGCCCTGGTCCGAGGACGCCTGGCGGCGC
ACGGTCGCCGAGGCCGGCGCCCGGCACGAGATGCTGCGCACCTCCTTCGACCCCCACGGC
TTCGGCGAACCCCTCCAACTCGTCCACCGCGACGCCCGCCCCCGCATCACCTTCGAGGAC
CTGCGCGAACGGGACGCCGCCGGGCGGCAGGCGGCCGTCGCCGCGCGGTACGAAGCCGAA
CGCGCCAATCCGTTCGCCTGGGACGAGGCGCCGCTGATCCGCTTCCATGTGCAGCGCCGC
ACCGACACGGCCTTCCAGCTGTTCATCGCCGAGCACCACGCCGTCATGGACGGCTGGAGC
GAGCGCTCCCTGCTCACCGAACTCCTCTCCCGCTACGTCGAGTTGTGCGCCCCCGGGGAC
GGCGCGGCACCGTCGGCCCCCGCACCCCGCTCCCGCTTCGCCTCGTTCGTCGCACTGGAG
CGGGACGCGCTCGCCGACCCCGCTGCGCGCGCCTTCTGGGACGAGGTGACGCAGGACGCC
CCCGTGACCCGCCTGCCGCGCAGCGCCACCACCGGGGGAGCGCCACGTATGACCTGGCAC
CACGCCCCGCTGCCCGGCGGACTCCACGAGCGGCTGTCCGCGCTCGCCGCCGCGCTCGGC
GTGCCGCTGCGCACCGTGCTGCTCGCCGCCCACACGCGGGTCATGGCCCTGATGGGCGGC
GCGGACGAGATCACCACCGGCGTCGTGGTCAACGGGCGCACGGAGGAGGCCGACGGCGAC
AAGGTCGTCGGAGCCTTCCTCAACACGCTGCCCTGCCGCCTCACCGTCACCCGGGAGAGC
TGGCGGGACCTCGTGCGCCGCGTCGCCGAACTGGAGCTGCGGGCGCACGAGCACCGGCGC
TACCCGCTCGCCGAGATCGTCCGCCGCAACGGCGGGACGGCACCGTTCGAGACCTTCTTC
AACTACACCCACTTCCACGTCGAACACGACGGGCCGTCCGCCGGGACGTTCACCGTCCTG
GAGGAGACCGGCGAAGCCGCCACGGACATGGCGTTCGGCGCGGAGTTCTCCCGCACCCCC
GACGGGCGCGCCCTGGAACTGGGCCTGCGGTACGACGCGGCACGGTTCACCGCCGAGCGG
ATGGCCGCGCTGCACGACTCCTACACGGCGGCGCTGCGGGCGCTGGCCGACACACCCGAC
CTGGACTGCACCGAGGCCGACCTGGTGCCGCCGCAGGACCACCGCCGGCACGCCGTGTGG
AACGACACCGCGCGGCACTACGACGCCCCGCACACGCTGACCGGGCTGATCGAACGGCAG
GTCCGGCGAACGCCCGACGCGCCGGCTGTCCGCTTCGAGGGCACCGCACTCGGCTACCGG
CAGCTCGACGAGGCCGCCGAACGCCTCGCCGCGCGACTGCGGGCCCTCGGCGCCCGGCCC
GGTGCCTTCGTGGGCCTGCTCATGGACCGCTCCCTCCTGCTGCCGGTCGCGCTGCTCGCG
GTGCTCAAGTCCGGTGCCGCGTACGTGCCGCTGGACCCCGACCACCCCGAGGCGCGCACC
CGGGCGCTGCTCAGCCAGGCCGGCATCGGCCTGGTCGTCGCGGACGGCCGCCGGGCGGGG
GCGCTGCGGGCGGCCGGCCCTGCCGACGCCCCCACGGTGACCGTCGTCGTCCCCGACGAA
CCGGGCCCCGCAGCGGACTCCGCCGCCGTCCCCGTGACCGCCGCGGGTCCGGACGACCCC
GCCTACATGATCTTCACCTCGGGCTCGACGGGCACTCCGAAGGGCGTGGTGGTCGCCCAC
CGCGCCATCGCCAACCGCCTGCTGTGGATGCAGGAGGCCTACGGGCTGAACCCCGGCGAA
CGCGTCCTGCAGAAGACGCCGTACACGTTCGACGTGTCGGTGTGGGAGTTCTTCTGGCCC
CTGCTCACCGGCGGCGTACTCGTCCTTGCCCGCCCCGGCGGCCAACGCGACCCCGCCTAC
CTGGCCGGTCTCGTCGCCGAGGAGGGCGTCAGCACCGTGCACTTCGTGCCGTCCATGCTC
GACGTCTTCCTCGACGACCCGCTCGCGGTCCGGCGCGCCGCCGGTCTCACCCGCGTGCTG
TGCAGCGGCGAGGCCCTGCCCCACGAGGTGCAGACCCGCTTCCTCGACCTGCTCCCGCAC
GTCGAGCTGCACAATCTGTACGGGCCGACGGAGGCCGCCGTCGACGTCACCGCGTGGCAC
TGCCTGCCCGGCGCCGGGGACACCGTGCCGATCGGCCGGCCCATCGCGAACATGCGCACC
CATGTGCTGGACGCACGCCTGCGCGAGGTTCCGACGGGCGTCACGGGCGAGCTGTTCCTC
GAAGGGGTCGGACTGGCCCTCGGCTACCACGGGCGCCCGGACCTGACCGCCGAACGGTTC
GTGCAGCTCACCGGCGCCGACGGCGTCACCCGGCGCCTGTACCGCACCGGCGACCTCGCC
CGGCACCGGACGGACGGCGCCCTGGAGTACGCCGGGCGCACCGACCACCAGATGAAGATC
CGCGGCTTCCGCGTCGAGCCCGGCGAGATCGAGGCCGCCCTCGCCGAGCACCCCGAGGTC
CGCGCCTGCGCCGTACTGCTCCACGGCGAACGTCTGACCGGCTACGTCGTGCCCACCGGT
GACACCGGTGACACCGCTGACATCGGCGGCACCGGCGGCACCGCGGCGGACGAGGCCGCG
GCCGGGGCGGCTCTCGATACCTACGCCCGCACCCGGCTCCCGCGGCACATGGTGCCGTCG
GCGTGGGTGCTGCTCGACGCGCTGCCCCTGACCCGCAACGGCAAGCTCGACCGGGCGGCC
CTGCCCGCCCCGGACCCGGCGCACGCGGTCCGCCGGACCCCGTCCCGCCCGCCACGCGGC
GCCACCGAGACCCGTCTCGCCGGTCTGTGGGAACAGATCCTCCGCACCGGACCCGTCGGC
GCCGACGACGACTTCTTCGCCGCCGGCGGCCACTCGATCGACGCCCTGCGCCTCATCGGC
CGGATCAACGAGGCGTTCGGTGAGCGCCTGTCGGTGGCCACCGTGATGGAACACCCCACC
GTCGCCCGGCAGGCGCAGGCCCTGCGCGCCCGCCGGCGATCCGGCACGGCGGACACCGTC
GTCCGCATCCGGCCGGACGGCGACCTGGATCCGCTCGTCCTCGTCCACCCCGTCGGCGGC
AACGTCCTGTGCTACCGCTCCCTCGCGACGGCGCTGCGACCGGGCCGGCCGGTGTACGGC
CTGTCGGCGCCCGGGCTGACGACCGCCGCCCCGGACGGCGCCGGGGACGCGGGCGTGCAG
GAGCTCGCGGCCGTCCACGTCGCGGCCCTGCGCACCGTCCGCCCCCACGGGCCGTACCAC
CTGGCCGGCTGGTCCCTCGGCGGGTTGCTCGCCTACGAGATGGCCCACCAGCTCCGCGCC
GACGGCGAGGAAGTGGCCACGCTCACCCTGCTCGACACCGCCTACCCCGGGACCACGGAC
GTGCCCGCCGACGGCATCGCACTTCTGGAGTGGTTCCACGACGACCTCGCCCGCTCCGCG
GGCGCCGACCCAGGCGCCGCCGCACGGGACGCCCTGCGCGCCGCGCTGGAGGCGGCGGAC
GGCACCCCGGCCCAGCTGCGGGCCGTCGCCGCAGCCCTCGCCGTGGACGGCCGCGTGCCG
GCCCTCGACACGGCCGCACTGGCCCGGCACCACGCCGTGTTCCGCACCGGACTGCTGGCC
GCCTCCCGCTACCGGCCGCCCGTGGCGTCGGGCACCGTCCACTTCCACCAGAGCACCACC
GGTGCCGCGCTGCACTCCGCCGACCGGTGGGCGACACGAGTGCCGGACGGTCTCGTGCGC
CACGACAGCGACGCCGACCACTACGCACTGGTCAGGGCCCCCCACGTGCGGGCCGTCGCC
GCCGCCCTCGACGCCGCCCTCGACGCCGCTCTCGGCCCGGCCGCCCGGCCGGACGGGCAC
CGCGTCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [518-922]  5.50000000000008e-115 PF00501 [1599-2005]  1.69999999999998e-114 PF00501
PF00501   AMP-binding
IPR001031 Thioesterase (Domain)
 [2191-2444]  5.30000000000001e-29 PF00975
PF00975   Thioesterase
IPR001242 Condensation domain (Domain)
 [26-331]  1.09999999999999e-62 PF00668 [1115-1416]  1.5e-43 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1043-1058]  PS00012 [2127-2142]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1021-1082]  3e-11 PF00550 [2105-2167]  8.40000000000001e-14 PF00550
PF00550   PP-binding
 [1010-1087]  2.59999999999998e-47 G3DSA:1.10.1200.10 [2091-2173]  2.59999999999998e-47 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1018-1084]  PS50075 [2102-2169]  PS50075
PS50075   ACP_DOMAIN
 [1011-1085]  2.89999717862184e-16 SSF47336 [2095-2170]  1.50000306971104e-18 SSF47336
SSF47336   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [518-922]  TIGR01733 [1599-2005]  TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [638-649]  PS00455 [1723-1734]  PS00455
PS00455   AMP_BINDING
SignalP
 [1-21]  0.097 Signal
Eukaryota   
TMHMM No significant hit