close all open/close all

CDS information : Kirro_00480


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction113,005 / 114,624 / + [in whole cluster]
113,005 / 114,624 / + [in contig]
Location113005..114624 [in whole cluster]
113005..114624 [in contig]
TypeCDS
Length1,620 bp (539 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative argininosuccinate lyase
Gene
Gene (GenBank)
EC number4.3.2.1
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative argininosuccinate lyase]
MIPDAAPVTPSPGPTTPPHRTDTVTVTSQPPAPAAELSGRIRGGPSDLLHDEVLAPQFRF
EVRHLLGHYIAIEKTLAAEYARMALLTEAEARTVTALLDEVGPGALTARPDANMSDIAFA
LERHVTARLPAPVPHWHVDRSRNDLQACAQTMFGREQVVRLATALLDLCSVVLARAEETR
GLPMPGYTHFQAAQIITPGFHLSALAEQLLHTQRRLLHTYDGMNTCPLGAGAMAGQELPW
DRTRMARMLGFDRPQPNALTAVASRRWSAEATAELGLLGAALSRFVTDLLTWGGSEYGFI
ELPDDLSGISSAMPQKKNYPVLERIRGRTAHLGAFHTDVLLGQRNTPFCNLVEVSKEAGT
HVLTAFDSAHGTVRLLTEVVRRVAFRADRMRAVCTREYLGGFSLANALTLTEGVPWRTAQ
VVAGKYIVSAAEAGVPPHPGAPALLTRAAAEHALTLADPARLLADAFDVDRGLARLACEG
SAHPDAVAQALRAQQDTLEGLRAAWQERSDAVVAGAAETARALGPAGPQDAHRPETGER
selected fasta
>[putative argininosuccinate lyase]
GTGATCCCCGACGCCGCACCGGTCACCCCTTCACCGGGCCCCACCACCCCACCGCACAGA
ACGGACACCGTCACCGTGACGAGTCAGCCCCCGGCGCCCGCCGCCGAACTCAGCGGCCGC
ATCCGCGGCGGGCCGAGCGACCTGCTGCACGACGAGGTACTCGCACCCCAGTTCCGGTTC
GAGGTCCGCCACCTGCTGGGCCACTACATCGCCATCGAGAAGACCCTGGCGGCCGAGTAC
GCCCGGATGGCGCTGCTCACCGAGGCAGAGGCCCGCACCGTCACCGCCCTGCTGGACGAG
GTGGGGCCCGGGGCCCTCACCGCACGGCCCGACGCCAACATGTCGGACATCGCCTTCGCC
CTCGAACGCCACGTCACGGCCCGGCTGCCGGCCCCCGTGCCCCACTGGCACGTCGACCGC
AGCCGCAACGACCTCCAGGCCTGCGCGCAGACGATGTTCGGCCGCGAGCAGGTGGTCCGC
CTCGCCACCGCCCTGCTCGACCTGTGCTCCGTCGTCCTCGCCCGCGCCGAGGAGACCCGC
GGCCTGCCCATGCCCGGCTACACGCACTTCCAGGCCGCGCAGATCATCACCCCCGGCTTC
CACCTGTCCGCTCTCGCGGAGCAGCTGCTGCACACCCAGCGGCGGCTGCTGCACACCTAC
GACGGGATGAACACCTGCCCGCTGGGCGCCGGCGCGATGGCCGGACAGGAACTGCCCTGG
GACCGCACGCGGATGGCCCGCATGCTGGGCTTCGACCGCCCGCAGCCCAACGCGCTCACC
GCGGTCGCCTCGCGCCGCTGGAGTGCCGAGGCCACCGCCGAACTCGGCCTGCTCGGCGCC
GCCCTGAGCCGCTTCGTCACCGACCTGCTCACCTGGGGCGGCAGCGAGTACGGCTTCATC
GAACTGCCCGACGACCTGTCCGGCATCTCCTCGGCGATGCCGCAGAAGAAGAACTACCCC
GTCCTGGAACGCATCCGCGGCCGCACCGCCCACCTCGGCGCCTTCCACACCGACGTCCTC
CTCGGGCAGCGCAACACCCCCTTCTGCAACCTGGTGGAGGTCTCCAAGGAAGCCGGCACC
CACGTCCTGACCGCGTTCGACTCCGCGCACGGCACCGTCCGGCTGCTCACCGAGGTGGTC
CGCCGCGTCGCGTTCCGGGCCGATCGCATGCGCGCGGTGTGCACACGCGAGTACCTGGGC
GGCTTCAGCCTCGCCAACGCCCTCACCCTCACCGAAGGGGTGCCGTGGCGGACCGCGCAG
GTCGTCGCCGGCAAGTACATCGTGAGCGCCGCCGAGGCCGGCGTACCGCCCCATCCGGGC
GCGCCCGCACTGCTGACCCGGGCCGCCGCCGAGCACGCGCTCACTCTCGCCGACCCGGCG
CGGCTGCTCGCCGACGCCTTCGACGTCGATCGGGGCCTCGCCCGCCTCGCCTGTGAGGGC
TCCGCCCACCCCGACGCCGTGGCGCAGGCACTGCGCGCCCAGCAGGACACCCTCGAGGGA
CTGCGCGCCGCCTGGCAGGAGAGGTCCGACGCCGTCGTCGCGGGAGCCGCCGAGACGGCC
CGCGCACTCGGCCCGGCCGGACCGCAGGACGCCCACCGGCCGGAAACGGGGGAGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000362 Fumarate lyase (Family)
 [181-199]  9.00000407957274e-07 PR00149 [265-292]  9.00000407957274e-07 PR00149 [309-325]  9.00000407957274e-07 PR00149
PR00149   FUMRATELYASE
IPR003031 Delta crystallin (Family)
 [135-157]  1.29999924468179e-20 PR00145 [176-196]  1.29999924468179e-20 PR00145 [227-243]  1.29999924468179e-20 PR00145 [265-289]  1.29999924468179e-20 PR00145 [309-325]  1.29999924468179e-20 PR00145
PR00145   ARGSUCLYASE
IPR008948 L-Aspartase-like (Domain)
 [59-499]  6.90004508941104e-71 SSF48557
SSF48557   L-Aspartase-like
IPR022761 Lyase 1, N-terminal (Domain)
 [75-327]  4.9e-30 PF00206
PF00206   Lyase_1
SignalP
 [1-34]  0.182 Signal
Bacteria, Gram-negative   
TMHMM No significant hit