close all open/close all

CDS information : Kirro_00490


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction114,624 / 115,607 / + [in whole cluster]
114,624 / 115,607 / + [in contig]
Location114624..115607 [in whole cluster]
114624..115607 [in contig]
TypeCDS
Length984 bp (327 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MPPAPLSGPAAAPAAPAPVTGTGYAFGTFGELLQGALPAPDGDFLVTFPLARWATAVFHP
ARAARTVHVTPAHKGKSRRVAEAVLAALGENDGGLLELGGDLPEGKGMASSSADLVATVR
AVGAAYRRTFSPAQTEAFLRGVEPADGVMYDEIVCFHHRAVRLGRRLGTLPPLTVVAHDE
GGQVDTVAHNRAAPPIGPAERHEYARLLDRLGDAVATGDVPAVGEVATRSAELNDRRRAR
AGFGVLRALCHDVGGHGLVLAHSGTLLGVLLDTHDPELDAKARHIRAGCAPLGGEVTVHR
ALGAGDAWSPGPYPAVPAGSTTHRRET
selected fasta
>[hypothetical protein]
ATGCCGCCCGCTCCGCTGAGCGGCCCGGCCGCCGCCCCCGCCGCTCCGGCACCGGTCACC
GGCACCGGGTACGCCTTCGGCACCTTCGGCGAACTCCTCCAAGGCGCCCTGCCCGCCCCC
GACGGCGACTTCCTCGTCACCTTCCCGCTGGCCCGCTGGGCCACCGCCGTCTTCCACCCG
GCCCGGGCCGCACGGACCGTACACGTCACGCCCGCGCACAAGGGCAAGTCCCGGCGGGTG
GCGGAAGCCGTCCTGGCAGCGCTCGGCGAGAACGACGGCGGACTGCTGGAACTCGGCGGC
GACCTGCCCGAGGGCAAGGGCATGGCCAGTTCCTCGGCCGACCTGGTCGCCACCGTGCGG
GCCGTCGGCGCCGCGTACCGGCGCACGTTCAGCCCCGCGCAGACCGAGGCCTTCCTGCGC
GGCGTCGAACCCGCCGACGGCGTCATGTACGACGAGATCGTCTGCTTCCACCACCGGGCC
GTCCGGCTCGGCCGCAGACTCGGCACGCTGCCCCCGCTCACGGTCGTCGCCCACGACGAG
GGCGGACAGGTCGACACCGTCGCCCACAACCGGGCCGCCCCGCCCATCGGGCCTGCCGAA
CGCCACGAGTACGCCCGGCTGCTGGACCGGCTCGGCGACGCCGTCGCCACGGGTGACGTA
CCCGCCGTCGGCGAGGTCGCCACCCGCAGCGCCGAACTCAACGACCGCCGACGCGCCCGC
GCCGGATTCGGCGTCCTGCGCGCGCTGTGCCACGACGTCGGCGGCCACGGCCTGGTCCTG
GCCCACAGCGGCACCCTGCTCGGCGTCCTCCTCGACACCCACGATCCCGAACTCGACGCC
AAGGCACGGCACATCCGTGCCGGCTGCGCACCGCTCGGCGGCGAGGTCACCGTGCACCGC
GCGCTGGGCGCCGGGGACGCCTGGAGCCCCGGCCCGTACCCGGCCGTCCCGGCCGGCTCC
ACCACCCACCGACGGGAGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006204 GHMP kinase N-terminal domain (Domain)
 [99-133]  4.69999999999999e-06 PF00288
PF00288   GHMP_kinases_N
IPR012363 Propanediol utilisation/coumermycin biosynthesis, PduX-related (Family)
 [1-305]  2.500009099162e-84 PIRSF033887
PIRSF033887   PduX
IPR014721 Ribosomal protein S5 domain 2-type fold, subgroup (Domain)
 [72-133]  1.3e-06 G3DSA:3.30.230.10
G3DSA:3.30.230.10   Ribosomal_S5_D2-type_fold
IPR020568 Ribosomal protein S5 domain 2-type fold (Domain)
 [18-179]  1.99999636034521e-20 SSF54211
SSF54211   Ribosomal_S5_D2-typ_fold
SignalP
 [1-21]  0.722 Signal
Eukaryota   
 [1-14]  0.51 Signal
Bacteria, Gram-negative   
TMHMM No significant hit