close all open/close all

CDS information : Kirro_00500


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction115,610 / 117,883 / + [in whole cluster]
115,610 / 117,883 / + [in contig]
Location115610..117883 [in whole cluster]
115610..117883 [in contig]
TypeCDS
Length2,274 bp (757 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative pyridoxal-phosphate dependent enzyme
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative pyridoxal-phosphate dependent enzyme]
MLFDTLTDAIGRTPLVRLRLGAERGVEVYAKLELQNLFAMKDRVARNILLEARALGTLRP
GAPVVESSSGTMALGVALVGRSLGHEVHIVTDPRIDPVTLAKLRALGCRVHVVEAMTSHG
WQSARLERLAELMAELPGAFWPQQYTNPDNPGAYRGLARELLDSLGHIDTLVGAVGSGGS
LCGTGRVLRETLPDVRVVGVDCVGSALFGQPDVPQRLQSGLGNSLLPKNLDRLLVDEVHW
LNDHEAFAATRDLAREQQIFGGNTSGSVYRVLGDLARRAEPGSRIVGILPDRGDRYADTV
YSDDHWEEHALHTLPAADRPAVVTAGTAVTTWSRQTYRAPDDLRRHLVFVESNTTGTGML
ALDLARDTLGTEPVLLTGDPGRYRGLEATGAEVIRCDTNSDAALRAALQDRFRREEIAGV
TTTSDFYVPAAARLARWLGLPGNPPEAVTACRDKSALRALLRRAGVHQPRYAVVREPGEV
AAAVARTGLPCVVKPADDSGSVNVLLCTDEAQARAQAERILAVTTNVRGMPTARTVLVEE
YLDGPEYSVEMFSQDGEAVCVGITAKSVTGDPHFVEHRHLFPAPLPAATAERITETVMAA
LDAAGIRLGATHTEVKLTGSGPAVIEINPRPAGGMIPELVRLASGVDLLEQQLKAATGQA
PDLKPGHGAHAGIQFLLADADGVLDAVDGVARARAVDGVEAVTVTVAPGAVVRRARSAGD
RVGHVIACRPGPEQVTAALDEARDLLRLTVGEPAGAR
selected fasta
>[putative pyridoxal-phosphate dependent enzyme]
ATGCTGTTCGACACGCTGACGGACGCGATCGGCCGCACGCCGCTCGTCCGGCTGCGCCTC
GGCGCGGAACGCGGGGTGGAGGTCTACGCCAAGCTGGAACTCCAGAACCTGTTCGCGATG
AAGGACCGGGTCGCGCGCAACATCCTCCTGGAGGCCAGAGCGCTCGGCACCCTGCGCCCC
GGCGCCCCCGTGGTGGAGAGCTCCTCCGGCACCATGGCGCTCGGTGTCGCCCTCGTCGGC
CGCTCCCTCGGCCACGAGGTGCACATCGTCACCGACCCCCGCATCGACCCCGTCACCCTG
GCGAAGCTGCGCGCCCTGGGCTGCCGCGTGCACGTCGTCGAGGCGATGACCAGCCACGGC
TGGCAGTCCGCACGCCTGGAGCGGCTCGCGGAACTGATGGCGGAACTGCCCGGCGCCTTC
TGGCCCCAGCAGTACACCAACCCCGACAACCCCGGCGCCTACCGCGGCCTGGCCCGTGAA
CTGCTCGACAGCCTCGGCCACATCGACACCCTGGTCGGCGCGGTGGGCAGCGGCGGCTCG
CTGTGCGGGACGGGCCGCGTGCTGCGCGAGACGCTGCCCGACGTCCGCGTCGTCGGCGTC
GACTGCGTCGGCAGCGCCCTCTTCGGGCAGCCGGACGTGCCGCAGCGGCTGCAGAGCGGC
CTCGGCAACAGCCTCCTGCCGAAGAACCTCGACCGCCTGCTCGTCGACGAGGTCCACTGG
CTCAACGACCACGAGGCGTTCGCCGCCACCCGCGACCTCGCCCGCGAACAGCAGATCTTC
GGCGGCAACACCTCCGGCTCCGTCTACCGCGTCCTCGGCGACCTCGCCCGGCGCGCCGAA
CCCGGCTCCCGCATCGTCGGCATCCTGCCCGACCGCGGCGACCGCTACGCCGACACCGTC
TACAGCGACGACCACTGGGAGGAGCACGCCCTGCACACCCTGCCGGCAGCGGACCGTCCC
GCCGTCGTCACCGCCGGGACCGCCGTCACCACCTGGTCCCGGCAGACCTACCGCGCACCC
GACGATCTGCGCCGCCACCTCGTGTTCGTCGAGTCCAACACCACCGGCACCGGCATGCTC
GCCCTCGACCTCGCCCGGGACACGCTCGGGACCGAGCCCGTGCTGCTGACCGGCGACCCC
GGCCGCTACCGGGGGCTGGAGGCCACCGGCGCCGAGGTGATCCGGTGCGACACCAACTCC
GACGCGGCGCTGCGGGCCGCGCTCCAGGACCGCTTCCGCCGCGAGGAGATCGCCGGTGTC
ACCACCACCAGCGACTTCTACGTCCCCGCCGCCGCGCGCCTGGCCCGCTGGCTCGGCCTG
CCGGGCAACCCGCCCGAGGCGGTGACCGCCTGCCGCGACAAGTCGGCCCTGCGGGCCCTG
CTGCGGCGGGCCGGGGTGCACCAGCCCCGGTACGCGGTGGTGCGCGAGCCCGGAGAGGTG
GCCGCGGCCGTCGCGCGGACCGGGCTGCCGTGCGTGGTCAAGCCCGCCGACGACTCCGGC
TCGGTCAACGTGCTGCTGTGCACCGACGAGGCCCAGGCCCGCGCCCAGGCCGAGCGGATC
CTCGCCGTCACCACCAACGTCCGCGGGATGCCGACCGCGCGGACCGTCCTCGTCGAGGAG
TACCTGGACGGCCCCGAGTACAGCGTGGAGATGTTCAGCCAGGACGGCGAGGCGGTCTGC
GTCGGCATCACCGCCAAGTCCGTCACGGGCGACCCCCACTTCGTGGAGCACCGCCACCTC
TTCCCCGCCCCGCTGCCGGCCGCCACCGCCGAGCGGATCACCGAGACCGTGATGGCCGCC
CTGGACGCGGCCGGCATCCGCCTCGGCGCCACCCACACCGAGGTGAAGCTGACCGGGAGC
GGACCGGCCGTGATCGAGATCAACCCGCGCCCCGCGGGCGGCATGATCCCCGAGCTCGTC
CGGCTGGCCAGCGGCGTCGACCTGCTGGAACAGCAGCTGAAGGCCGCGACCGGACAGGCA
CCCGACCTCAAGCCCGGCCACGGCGCCCACGCCGGCATCCAGTTCCTGCTCGCCGACGCC
GACGGGGTCCTCGACGCCGTCGACGGCGTGGCACGGGCGCGGGCCGTGGACGGCGTCGAA
GCGGTGACCGTCACCGTCGCACCCGGCGCCGTGGTCCGCCGCGCACGCAGCGCGGGCGAC
CGCGTGGGGCACGTCATCGCCTGCCGTCCGGGCCCCGAGCAGGTGACGGCGGCGCTGGAC
GAGGCGCGGGACCTGCTCCGGCTCACGGTCGGCGAGCCCGCCGGCGCGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001926 Pyridoxal phosphate-dependent enzyme, beta subunit (Domain)
 [1-310]  2.59998233910302e-69 SSF53686
SSF53686   PyrdxlP-dep_enz_bsu
 [7-290]  1.2e-36 PF00291
PF00291   PALP
IPR011761 ATP-grasp fold (Domain)
 [458-657]  PS50975
PS50975   ATP_GRASP
IPR013815 ATP-grasp fold, subdomain 1 (Domain)
 [445-542]  1.7e-16 G3DSA:3.30.1490.20
G3DSA:3.30.1490.20   ATP_grasp_subdomain_1
IPR013816 ATP-grasp fold, subdomain 2 (Domain)
 [544-634]  1e-09 G3DSA:3.30.470.20
G3DSA:3.30.470.20   ATP_grasp_subdomain_2
SignalP No significant hit
TMHMM No significant hit