close all open/close all

CDS information : Kirro_00510


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction117,976 / 118,200 / + [in whole cluster]
117,976 / 118,200 / + [in contig]
Location117976..118200 [in whole cluster]
117976..118200 [in contig]
TypeCDS
Length225 bp (74 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative MbtH-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative MbtH-like protein]
MSNPFENDDAVYLVVRNDELQHSLWPADLPVPAGWTTVHGPDGRQDCLDFVERNWTDMRP
ASLVAALAGDTARG
selected fasta
>[putative MbtH-like protein]
ATGAGCAACCCCTTCGAGAACGACGACGCCGTCTACCTGGTCGTCCGCAACGACGAGCTC
CAGCACTCGCTGTGGCCCGCCGACCTGCCCGTGCCCGCCGGCTGGACCACGGTCCACGGC
CCGGACGGCCGCCAGGACTGCCTCGACTTCGTCGAGCGGAACTGGACCGACATGCGGCCC
GCTTCCCTGGTCGCGGCCCTCGCCGGGGACACGGCCCGTGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005153 MbtH-like protein (Domain)
 [1-53]  1.1e-25 PF03621
PF03621   MbtH
 [3-53]  3.39999972437719e-33 SM00923
SM00923   MbtH
IPR015166 Protein of unknown function DUF1922 (Family)
 [11-69]  6.90000000000001e-28 G3DSA:3.90.820.10
G3DSA:3.90.820.10   DUF1922
SignalP No significant hit
TMHMM No significant hit