close all open/close all

CDS information : Kirro_00520


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction118,193 / 120,250 / + [in whole cluster]
118,193 / 120,250 / + [in contig]
Location118193..120250 [in whole cluster]
118193..120250 [in contig]
TypeCDS
Length2,058 bp (685 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative non-ribosomal peptide synthetase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>[putative non-ribosomal peptide synthetase]
MAEPVRPLPGPGAPDVPAAGTALAGRASAGAEALPDDTAPPAGQDTRAARNGGDGASMPG
GDWMSGAASAPEYDEASGPERQGAAAPEASAPHDGGSSGAACGSVDALRRLVAQVLGLAA
DAVGAGQGFTELGGDSIQAIQVVSRARAAGLLLTTRDVLRSDSLAALATTARSTDGPGAG
EGPAEPPRRTGPVAATPIMAWLGELDGPVDTYHQSLVVRTPAAFRAEHAVRVVQSLLDTH
DMLRLTVPGGAGAAAAECFVPPPGGIDAHTLVEHVHAPDATDTELPALTAGRIAAARHSL
SPADGVMVRAVLVDRGPLRQGRLALVVHHLVVDGVSWRILQDDLRTCWERLAAGQDPVLE
PAPTPFAHWADLIAADATSGRRMAEATRWAETLRPAPEPLGGICPLDRLDPESADRRLTL
TLPPEVAEPLLTAVPGIVNGTVNDVLLTGLALAVLAWRRPVTGPADGGTVLVDVEGHGRQ
DIAGAPDLSRTVGWFTTVHPVRFDLGRPDLDDVRTDGPAAGAVLRMVKETLRAVPDHGIG
HGLLRHGNSRTRPALAALGVPEIGFNYLGRFPMGDSADWSAAPGHDVALDESDDGLAMAH
AVEVNAAAHDGPGGTALSATWTWAGNACPDDRAHALAHEWFAVLRALVAYAELPGAVGLT
PSDVSLPGLGQADLDAFEAQFGELL
selected fasta
>[putative non-ribosomal peptide synthetase]
GTGGCTGAGCCCGTACGTCCGCTGCCCGGCCCCGGCGCACCTGACGTACCGGCGGCCGGG
ACGGCCCTGGCGGGCCGGGCCTCGGCCGGGGCCGAGGCCCTCCCGGACGACACCGCGCCA
CCTGCCGGGCAGGACACACGTGCCGCCCGGAACGGCGGCGACGGGGCGAGCATGCCGGGC
GGCGACTGGATGTCCGGGGCGGCGTCCGCGCCGGAGTACGACGAGGCGTCCGGGCCGGAG
CGCCAAGGGGCAGCCGCGCCCGAGGCGTCCGCACCGCACGACGGCGGCTCGTCCGGGGCC
GCGTGCGGCTCCGTGGACGCCCTGCGGCGGCTGGTCGCCCAGGTGCTGGGGCTGGCCGCC
GACGCCGTCGGGGCCGGGCAGGGGTTCACCGAACTCGGTGGCGACAGCATCCAGGCCATC
CAGGTCGTCAGCCGCGCCCGGGCCGCCGGGCTGCTGCTCACCACCCGAGACGTCCTGCGC
AGCGACAGCCTCGCCGCGCTCGCCACCACCGCCCGCTCGACGGACGGCCCCGGCGCGGGC
GAGGGCCCGGCGGAACCACCGCGGCGCACCGGGCCCGTGGCCGCGACCCCGATCATGGCC
TGGCTCGGCGAACTCGACGGCCCCGTCGACACCTACCACCAGTCGCTCGTCGTCCGCACA
CCCGCGGCATTCCGCGCCGAGCACGCCGTCCGCGTCGTGCAGAGCCTCCTCGACACGCAC
GACATGCTGCGGCTCACCGTGCCCGGCGGGGCGGGCGCCGCTGCCGCGGAGTGCTTCGTG
CCGCCGCCGGGCGGGATCGACGCGCACACCCTCGTCGAGCACGTCCACGCGCCCGACGCC
ACCGACACCGAGCTGCCGGCCCTCACCGCCGGACGGATCGCGGCCGCCCGGCACTCGCTG
TCCCCGGCGGACGGCGTCATGGTGCGCGCCGTCCTCGTCGACCGGGGCCCGCTCCGGCAG
GGCCGGCTGGCGCTGGTCGTCCACCACCTCGTGGTCGACGGCGTGTCCTGGCGCATCCTC
CAGGACGACCTGCGTACCTGCTGGGAACGGCTCGCCGCGGGGCAGGACCCCGTCCTCGAA
CCCGCGCCCACGCCGTTCGCCCACTGGGCCGACCTGATCGCCGCCGACGCCACCTCCGGC
CGCCGGATGGCGGAGGCGACACGGTGGGCCGAGACCCTGCGCCCCGCCCCCGAACCCCTC
GGCGGCATCTGCCCGCTGGACCGCCTCGACCCGGAGAGCGCGGACCGCCGGCTCACCCTC
ACCCTGCCCCCGGAGGTGGCCGAGCCCCTGCTCACCGCGGTGCCCGGCATCGTCAACGGC
ACCGTCAACGACGTCCTGCTCACCGGGCTGGCCCTCGCGGTCCTCGCCTGGCGGCGCCCG
GTCACGGGCCCGGCGGACGGCGGCACCGTGCTGGTCGATGTCGAGGGCCACGGCCGCCAG
GACATCGCCGGCGCCCCCGACCTGTCGCGCACCGTCGGCTGGTTCACCACCGTCCACCCT
GTCCGCTTCGACCTCGGCCGGCCCGACCTGGACGACGTCCGCACGGACGGGCCCGCCGCC
GGGGCGGTGCTGCGCATGGTCAAGGAAACCTTGCGGGCCGTCCCCGACCACGGCATCGGC
CACGGCCTGCTGCGCCACGGCAACAGCCGTACCCGCCCCGCCCTCGCGGCCCTCGGCGTC
CCCGAGATCGGGTTCAACTACCTCGGCCGCTTCCCGATGGGCGACAGCGCCGACTGGTCC
GCCGCGCCCGGACACGACGTCGCCCTCGACGAGTCCGACGACGGCCTGGCGATGGCCCAC
GCGGTGGAGGTGAACGCCGCCGCCCACGACGGCCCCGGCGGCACCGCCCTCAGCGCCACC
TGGACCTGGGCGGGCAACGCCTGCCCCGACGACCGCGCCCACGCCCTGGCCCACGAGTGG
TTCGCCGTGCTGCGCGCCCTCGTGGCGTACGCGGAGCTGCCCGGCGCCGTCGGGCTCACC
CCGTCCGACGTGTCCCTGCCCGGCCTCGGCCAGGCCGACCTCGACGCCTTCGAAGCCCAG
TTCGGAGAACTGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001242 Condensation domain (Domain)
 [206-505]  7.7e-31 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [131-146]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [105-207]  2.49999811956465e-11 SSF47336
SSF47336   ACP_like
 [106-168]  3.3e-09 PF00550
PF00550   PP-binding
 [104-172]  PS50075
PS50075   ACP_DOMAIN
 [106-173]  4.2e-16 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR010060 Non-ribosomal peptide synthase (Domain)
 [520-676]  1.2e-33 TIGR01720
TIGR01720   NRPS-para261
SignalP
 [1-33]  0.349 Signal
Bacteria, Gram-positive   
TMHMM No significant hit