close all open/close all

CDS information : Kirro_00530


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction120,247 / 123,468 / + [in whole cluster]
120,247 / 123,468 / + [in contig]
Location120247..123468 [in whole cluster]
120247..123468 [in contig]
TypeCDS
Length3,222 bp (1,073 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative non-ribosomal peptide synthetase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative non-ribosomal peptide synthetase]
MIPLSHAQRRLWFLSRDGDPGGQYNIPVGLRLHGALDRAALTIALTDVTARHEALRTVFP
HDDGVPRQHVLDPGTAPDLTVTAAPADEHPRRAREAAVPSFDLATRLPLRAHLFTDGDED
HYLLLVLHHIAGDGASLDVLLHDLSAAYTARLLGREPDWPDLPVQYPDYALWRHEVLGDP
ADPDSEHTRQLDHRARALAGLPEEHTLPTDRPRPAVASHRGAVVTAATGARTHARLAGLA
RDRRATVFMTVQAAFAALLTRLGAGTDLALGCPVDGRDDEALEHLVGLFVDTVVVRADTS
GGPAFTELLDRVRDAALDAHAHRDVPFDALVDRLNPPRTPGRHPLFQIAVAGRRDTGGAP
VLPGLRTRTEAVRTATAKFDLTLEVDERLDADDRPAGIGLILEYATDLFDAGTARLLLDR
LVRLLDAVAGDPTAPVAEHDLLTPGERAAVTEGWQGAPAVAHDTTVHALFARRAAAHPER
TAVVCGDRETGYGELDALAERVAAALADAGVRPGDTVALLMERSTDLIAGCLGVLKAGAA
YLPLDARAPRARSAAVVSAAGASVLLTDPGTDTDGLGVGHVLRPGEDEAAGRPSPDGRDD
DTAGAVPVTGRPDDLAYVMYTSGSTGTPKGVAVAHRDIVALALDRRWRGGAHDRVLFRSP
HAFDASTYELWVPLLTGGLVVVAPPGDLDVDGIARLIGDQRVTGTFLTATLFNELADRCP
QLLGTLREVMTGGEAASPAAVRRVRAHCPDTIVTNAYGPTETTTFAALFPLGPGDDIPAG
QVPIGRPLDGTRLHVLDDRLAPVPPGVTGELYIAGAGLARGYLGRPGLTAERFTACPSGP
PGTRMYRTGDLARWTRDGQVEYLGRADRQIKIRGLRIEPGEIENALAGHPDVGRAAVTVV
PGAAGPSLAGYVVAAEGRCPDPVALRAHLRGELPDWMVPLTITVLDRFPVTPNGKTDLAA
LPAPGPAAGERPYQAPRDDTERALAGLWERLLGVEHVGVHDDFFALGGHSLLATRLLAQV
RSLLGAAVTVRAFFAGPTVARLAEAARTAAVATPDDEPPVVRRARRAGHAGRV
selected fasta
>[putative non-ribosomal peptide synthetase]
GTGATCCCGCTGTCCCACGCCCAGCGCCGCCTGTGGTTCCTCAGCCGCGACGGCGACCCC
GGCGGCCAGTACAACATCCCGGTCGGGCTGCGTCTGCACGGCGCCCTCGACCGCGCCGCC
CTCACCATCGCCCTCACGGACGTGACCGCCCGGCACGAAGCGCTGCGCACCGTCTTCCCG
CACGACGACGGCGTCCCCCGGCAGCACGTCCTCGACCCCGGCACCGCCCCGGACCTGACG
GTCACCGCCGCCCCCGCCGACGAGCACCCCCGCCGCGCGCGGGAGGCCGCCGTGCCCTCC
TTCGACCTGGCGACCCGACTCCCGCTGCGCGCCCACCTGTTCACCGACGGCGACGAAGAC
CACTACCTGCTGCTGGTCCTGCACCACATCGCGGGCGACGGCGCCTCCCTCGACGTCCTC
CTGCACGACCTGTCCGCCGCCTACACCGCCCGGCTCCTCGGCCGGGAACCGGACTGGCCC
GACCTGCCCGTCCAGTACCCGGACTACGCCCTGTGGCGGCACGAGGTCCTCGGCGACCCC
GCCGACCCGGACTCCGAGCACACCCGGCAGCTCGACCACCGTGCCCGTGCCCTGGCCGGG
CTGCCCGAGGAGCACACCCTCCCCACCGACCGGCCCCGTCCCGCCGTGGCCTCCCACCGT
GGCGCCGTCGTCACCGCCGCGACCGGCGCCCGCACCCACGCCCGCCTCGCCGGCCTCGCC
CGCGACCGCCGTGCCACCGTCTTCATGACCGTCCAGGCCGCGTTCGCCGCCCTGCTCACC
CGCCTCGGCGCGGGCACGGACCTCGCCCTCGGCTGCCCGGTCGACGGCCGCGACGACGAG
GCGCTTGAACACCTCGTGGGCCTCTTCGTCGACACCGTCGTGGTCCGGGCCGACACCTCG
GGCGGCCCCGCGTTCACCGAGCTGCTCGACCGGGTCCGCGACGCCGCCCTGGACGCCCAC
GCCCACCGGGACGTGCCGTTCGACGCCCTCGTGGACCGGCTCAACCCGCCCCGGACACCC
GGCCGCCACCCCCTGTTCCAGATCGCGGTCGCCGGCCGTCGGGACACCGGCGGCGCGCCC
GTCCTGCCGGGCCTGCGGACACGGACGGAGGCCGTGCGCACCGCCACGGCCAAGTTCGAC
CTGACCCTCGAGGTCGACGAGCGCCTCGACGCGGACGACCGGCCCGCGGGCATCGGGCTC
ATCCTCGAATACGCCACCGACCTGTTCGACGCCGGCACCGCCCGACTGCTCCTGGACCGG
CTGGTCCGCCTCCTCGACGCCGTCGCCGGCGACCCCACCGCTCCGGTCGCCGAGCACGAC
CTGCTGACCCCCGGTGAGCGCGCCGCCGTCACCGAGGGCTGGCAGGGCGCGCCGGCCGTG
GCCCACGACACCACCGTGCACGCCCTGTTCGCGCGGCGGGCCGCGGCCCACCCCGAGCGC
ACCGCCGTCGTCTGCGGCGACCGGGAGACGGGCTACGGCGAACTCGACGCCCTCGCCGAG
CGGGTGGCGGCGGCCCTCGCGGACGCGGGGGTGCGACCCGGCGACACCGTCGCCCTCCTC
ATGGAGCGGTCGACCGACCTGATCGCCGGCTGTCTCGGCGTGCTGAAGGCCGGGGCGGCG
TACCTGCCGCTCGACGCCCGCGCACCGCGCGCCCGTTCCGCGGCGGTCGTGTCCGCGGCG
GGGGCGTCGGTCCTCCTCACCGACCCGGGCACCGACACCGACGGCCTCGGCGTCGGGCAC
GTCCTGCGACCCGGCGAGGACGAGGCCGCCGGCCGTCCCTCCCCGGACGGCCGCGACGAC
GACACGGCCGGGGCGGTCCCGGTCACCGGGCGCCCCGACGACCTCGCCTACGTGATGTAC
ACCTCGGGCTCCACCGGCACGCCCAAGGGCGTCGCCGTGGCCCACCGCGACATCGTCGCC
CTGGCCCTGGACCGGCGCTGGCGCGGCGGCGCCCACGACCGGGTCCTGTTCCGCTCCCCG
CACGCCTTCGACGCCTCCACCTACGAGCTGTGGGTGCCACTGCTCACCGGCGGCCTCGTG
GTGGTGGCTCCGCCCGGCGACCTGGACGTCGACGGCATCGCCCGGCTCATCGGCGACCAG
CGGGTCACCGGGACCTTCCTGACGGCCACCCTCTTCAACGAACTGGCCGACCGCTGCCCG
CAGCTGCTGGGCACCCTGCGCGAGGTGATGACCGGTGGTGAGGCCGCCTCCCCGGCCGCC
GTACGCCGGGTCCGCGCGCACTGCCCGGACACCATCGTGACCAACGCCTACGGGCCGACG
GAGACCACCACGTTCGCCGCGCTGTTCCCGCTGGGCCCCGGGGACGACATCCCGGCCGGC
CAGGTGCCGATCGGACGCCCCCTGGACGGCACCCGGCTGCACGTCCTCGACGACCGTCTC
GCTCCCGTCCCGCCCGGTGTCACCGGCGAGCTGTACATCGCGGGTGCCGGACTGGCCCGC
GGCTACCTGGGACGCCCCGGACTCACCGCGGAACGCTTCACGGCCTGCCCGTCGGGACCG
CCGGGCACACGGATGTACCGCACCGGCGACCTGGCCCGCTGGACGCGGGACGGCCAGGTC
GAGTACCTGGGGCGCGCCGACCGCCAGATCAAGATCCGCGGGCTGCGCATCGAGCCGGGC
GAGATCGAGAACGCCCTGGCGGGCCACCCGGACGTGGGCCGGGCCGCGGTCACCGTCGTG
CCGGGCGCCGCCGGTCCGTCGCTCGCCGGGTACGTGGTGGCCGCCGAGGGCAGGTGTCCC
GACCCGGTCGCGCTGCGCGCCCACCTGCGGGGCGAACTGCCGGACTGGATGGTCCCCTTG
ACGATCACGGTGCTCGACCGGTTCCCGGTGACCCCCAACGGCAAGACCGACCTGGCCGCG
CTGCCCGCGCCCGGCCCCGCCGCCGGGGAACGGCCCTACCAGGCGCCGCGCGACGACACC
GAACGCGCGCTCGCCGGGTTGTGGGAGCGGCTGCTCGGTGTGGAACACGTCGGCGTCCAC
GACGACTTCTTCGCCCTCGGCGGGCACTCCCTGCTCGCGACCCGCCTCCTCGCGCAGGTG
CGGTCCCTCCTCGGTGCCGCCGTCACCGTCCGGGCCTTCTTCGCGGGGCCCACGGTCGCC
CGGCTCGCGGAGGCCGCGAGGACCGCCGCCGTGGCCACCCCCGACGACGAGCCCCCGGTC
GTGCGCCGCGCCCGCCGCGCAGGCCACGCAGGCCGCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [492-897]  5.09999999999993e-112 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [1-299]  6.19999999999995e-57 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1005-1020]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [970-1048]  2.1e-26 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [980-1047]  PS50075
PS50075   ACP_DOMAIN
 [973-1048]  6.39998633403535e-19 SSF47336
SSF47336   ACP_like
 [983-1044]  1.2e-12 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [492-897]  4.59999999999996e-127 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [618-629]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit