close all open/close all

CDS information : Kirro_00540


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction123,771 / 127,067 / + [in whole cluster]
123,771 / 127,067 / + [in contig]
Location123771..127067 [in whole cluster]
123771..127067 [in contig]
TypeCDS
Length3,297 bp (1,098 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative non-ribosomal peptide synthetase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative non-ribosomal peptide synthetase]
MSRTPSAASPEPAAAQPVRSVPSTAPAQASPAVTGAGAAPKVEDVLPLSPLQEGILFHAL
FDERERDVYVAQLLLDLSGPLDAGRLRAAADAVLARHAALRAGFLRRASGEPAQVVRREA
PVPWEERDLSSLDAQGQADAVATLLAEDRSRRFDLTRPPLLRLTLLRTGPLSHRLLLTYH
HIVLDGWSWPVLVRELLALHDAGPDGAELPPVTPYASFLGWLGDRDTDAARDAWGRALEG
LAGGSRTAPVSGPSALLPHRVETVLTTVLTDRLTAFARAHRITPSTLLQGSWALLLANRL
RSDDVVFGAVVSGRPAELAGVADIVGLCINTVPVRVRVDRTEPLAGLFTRLQDEQARLIE
HHHLGLTEIQRTAGTGELFDSCVAFQNYPVDAAGLAALSTGDLRVVAVDPHDAAHYPLTL
TAIPGDRLRLQIDYRPDAFTAADAQALLDRLVRLLQAVADDPARPAGAVDLLSPAERQRV
LVEFNDTGRDEDYAEVTDRVRRQAHLRPNAVAVTDESGRELSYAELVVRADALAGRLRAE
GVEDGALVAVLGEPTARTPVALLAVLGAGAAYVPLDPDGPVVRTAGLLTAGAVPWLLTAP
EQRARAEEIAAAAAHPVRVLDLDDGAGRPSGQPSRDGGGRDALAYVCFTSGSTGRPKGAM
VHRRGMNNHLLAKLDDLRLTAEDGVVMNAPLTFDISVWQMLAPLITGGRVHLVSRDTARD
PDALFATVARHGITVMETVPSFVRAALDLWDSGVPQPALPALRWFVVNGEVLPPDLCTRW
YDRHPGAAIVNAYGLTECSDDNTHAFIGREVDGLLEQGRLPVGRPLRNNRLYILDPSLAP
VPPGVPGELFIAGTGVGPGYLNEPRRSSERYVPDPFAGEPGARMYRTGDLARLRADGQLD
FLGRQDHQVKIRGNRIELGEVETALRAVPDVGDAVVTVDRDGAGQQRLVGWFTGEADTDD
IRAALTRSLPAYMVPSLLFALPALPLTTNGKIDRRALPDPADLTRTAGRPPANATEEAVC
ALFAAVLGLAGAGPDDDFFAHGGHSLLATRLAGRLRSELGARLTIRDLFETPTPAGIAAR
LATAPAPARPALRPRARG
selected fasta
>[putative non-ribosomal peptide synthetase]
GTGAGCCGTACCCCGTCCGCCGCGTCGCCCGAGCCCGCCGCCGCGCAGCCCGTCCGTTCC
GTCCCCTCCACGGCCCCCGCGCAAGCCTCGCCGGCGGTCACCGGGGCGGGGGCCGCGCCC
AAGGTCGAGGACGTGCTGCCGCTCTCGCCCCTGCAGGAGGGCATCCTCTTCCACGCGCTC
TTCGACGAGCGCGAGCGGGACGTCTACGTGGCGCAGCTCCTGCTCGACCTGTCCGGCCCG
CTGGACGCCGGGCGGCTGCGCGCGGCCGCCGACGCCGTGCTGGCCCGCCACGCCGCCCTG
CGCGCCGGGTTCCTGCGCCGCGCCTCCGGCGAGCCCGCACAGGTCGTGCGGCGCGAGGCG
CCGGTGCCGTGGGAGGAGCGAGACCTGTCCTCGCTCGACGCGCAGGGTCAGGCCGACGCC
GTGGCGACGCTGCTCGCCGAGGACCGGTCCCGGCGTTTCGACCTGACGCGGCCGCCGCTG
CTCCGCCTCACCCTGCTGCGCACCGGACCGCTCAGCCACCGGCTGCTGTTGACGTACCAC
CACATCGTGCTGGACGGCTGGTCCTGGCCCGTGCTCGTGCGCGAGCTGCTCGCCCTGCAC
GACGCCGGACCCGACGGCGCCGAACTGCCCCCGGTCACCCCGTACGCGTCGTTCCTGGGC
TGGCTCGGCGACCGTGACACGGACGCGGCCCGCGACGCCTGGGGCCGGGCCCTGGAGGGG
CTGGCCGGCGGCAGCCGCACAGCGCCGGTCTCCGGCCCCTCCGCGCTGCTGCCTCACCGC
GTCGAGACCGTCCTCACCACCGTCCTCACCGACCGGCTGACCGCCTTCGCCCGCGCCCAC
CGCATCACCCCGAGCACCCTGCTGCAGGGCTCGTGGGCGCTGCTGCTCGCCAACCGGCTG
CGCTCCGACGACGTCGTCTTCGGCGCCGTCGTCAGCGGGCGCCCGGCCGAACTGGCGGGC
GTCGCCGACATCGTGGGCCTGTGCATCAACACCGTGCCGGTGCGGGTCCGCGTCGACCGC
ACCGAGCCCCTGGCCGGTCTGTTCACCCGGCTCCAGGACGAGCAGGCCCGGCTGATCGAG
CACCACCACCTCGGGCTCACCGAGATCCAGCGCACCGCCGGGACCGGTGAACTGTTCGAC
TCCTGCGTGGCCTTCCAGAACTACCCCGTGGACGCCGCCGGTCTCGCCGCGCTGTCCACG
GGCGACCTGCGGGTCGTCGCCGTGGACCCGCACGACGCGGCCCACTACCCGCTCACCCTG
ACCGCGATCCCCGGCGACCGGCTGCGCCTGCAGATCGACTACCGCCCGGACGCCTTCACG
GCCGCCGACGCACAGGCCCTGCTCGACCGTCTCGTCCGCCTCCTTCAGGCCGTGGCCGAC
GACCCGGCCCGCCCGGCGGGAGCCGTGGACCTGCTCTCGCCAGCCGAACGGCAGCGCGTG
CTGGTGGAGTTCAACGACACCGGCCGCGACGAGGACTACGCCGAAGTGACGGACCGCGTG
CGGCGCCAGGCGCACCTGCGGCCGAACGCCGTCGCGGTCACCGACGAGTCGGGCCGTGAA
CTGTCGTACGCCGAACTCGTCGTCCGGGCCGACGCCCTGGCCGGGCGGCTGCGGGCGGAA
GGAGTGGAGGACGGCGCCCTCGTCGCCGTCCTCGGCGAACCGACGGCCCGCACACCGGTC
GCGCTCCTCGCCGTCCTGGGCGCCGGGGCTGCCTACGTGCCGCTCGACCCGGACGGCCCG
GTCGTACGCACCGCCGGGCTGCTCACCGCCGGGGCGGTGCCGTGGCTCCTGACGGCACCC
GAACAGCGGGCGCGCGCCGAGGAGATCGCCGCGGCCGCCGCACACCCCGTGCGCGTGCTG
GACCTGGACGACGGCGCGGGCCGTCCGTCCGGGCAGCCGTCCCGGGACGGCGGCGGACGC
GACGCCCTGGCCTACGTGTGCTTCACCTCCGGATCCACCGGCCGCCCCAAGGGCGCCATG
GTGCACCGGCGCGGCATGAACAACCACCTGCTCGCCAAGCTCGACGACCTGCGGCTCACC
GCCGAGGACGGCGTGGTGATGAACGCGCCGCTCACCTTCGACATCTCCGTGTGGCAGATG
CTCGCCCCGCTGATCACCGGCGGCCGCGTCCACCTGGTCTCCCGCGACACCGCCCGCGAC
CCCGACGCACTGTTCGCGACCGTCGCCCGGCACGGCATCACCGTCATGGAGACCGTCCCC
TCCTTCGTGCGCGCCGCCCTCGACCTGTGGGACTCCGGCGTGCCGCAGCCCGCGCTCCCC
GCGCTGCGCTGGTTCGTCGTCAACGGCGAGGTGCTGCCGCCGGACCTGTGCACCCGCTGG
TACGACCGCCACCCCGGCGCGGCGATCGTCAACGCCTACGGGCTGACCGAGTGCTCGGAC
GACAACACGCACGCGTTCATCGGCCGGGAGGTGGACGGGCTGCTGGAGCAGGGCCGCCTG
CCGGTCGGCCGGCCGCTGCGCAACAACCGGCTCTACATCCTCGACCCGTCGCTGGCACCC
GTGCCGCCCGGCGTGCCCGGCGAACTCTTCATCGCCGGCACCGGTGTGGGGCCGGGCTAC
CTCAACGAGCCCCGTCGCAGCAGCGAGCGCTACGTCCCCGACCCGTTCGCCGGCGAACCC
GGCGCCCGGATGTACCGCACCGGCGATCTGGCCCGGCTGCGCGCCGACGGCCAGCTGGAC
TTCCTCGGACGCCAGGACCACCAGGTCAAGATCCGCGGCAACCGCATCGAACTCGGCGAG
GTGGAGACCGCGCTGCGGGCCGTGCCGGACGTCGGGGACGCGGTGGTGACCGTGGACCGC
GACGGCGCCGGGCAGCAGCGGCTCGTCGGCTGGTTCACCGGCGAGGCGGACACCGACGAC
ATCCGCGCCGCGCTCACCCGGAGCCTGCCGGCCTACATGGTGCCCTCGCTGCTGTTCGCG
CTGCCCGCCCTGCCGCTGACCACCAACGGTAAGATCGACCGCAGGGCCCTGCCCGACCCC
GCGGACCTCACCCGCACGGCGGGGCGTCCGCCGGCGAACGCCACCGAGGAAGCGGTCTGC
GCCCTCTTCGCCGCGGTCCTCGGCCTCGCCGGAGCCGGACCCGACGACGACTTCTTCGCG
CACGGCGGGCACTCCCTCCTCGCCACCCGGCTGGCCGGGCGGCTGCGCAGCGAACTGGGC
GCCCGGCTCACCATCCGCGACCTCTTCGAGACCCCCACCCCGGCCGGCATCGCGGCCCGG
CTGGCGACAGCACCCGCCCCGGCCCGCCCGGCCCTGCGCCCGCGTGCCCGTGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [522-936]  7.5e-101 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [43-339]  2.4e-59 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [1015-1082]  PS50075
PS50075   ACP_DOMAIN
 [1005-1084]  1e-25 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1017-1081]  2.1e-13 PF00550
PF00550   PP-binding
 [1008-1083]  1.60000240695997e-19 SSF47336
SSF47336   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [522-936]  1.10000000000001e-118 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [646-657]  PS00455
PS00455   AMP_BINDING
SignalP
 [1-27]  0.401 Signal
Bacteria, Gram-positive   
 [1-15]  0.321 Signal
Bacteria, Gram-negative   
 [1-15]  0.12 Signal
Eukaryota   
TMHMM No significant hit