close all open/close all

CDS information : Kirro_00550


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction127,105 / 128,673 / + [in whole cluster]
127,105 / 128,673 / + [in contig]
Location127105..128673 [in whole cluster]
127105..128673 [in contig]
TypeCDS
Length1,569 bp (522 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative amino acid adenylating enzyme
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative amino acid adenylating enzyme]
MHPDDIPVPLRIARQAARTPDATAVSAPEGELTYRTFDRRARAVAGELRAAGAGPEDTVL
VAVGRGADWAVAVLGIWYAGAAPLLVDPAAPDERLRALLAAARTRYAVVTGHVAAAALRR
RCGEELFWAGTRGEAPYAAADPAAVAPGSLAYVLFTSGSTGRPKPVAVGHAGLARQTAVL
AERYGLTAADRVLQFAAPAFDVSLEEALPTWCTGGTAVFVDDNLASPAELEPFLARRQVT
VVNLPTPYWAQWAKDVERRPRPLPPALRHVVIGSDAGRTADLVRWYAAGGPDVTSAYGLT
ESTITATCHATHPGPSAGTPDEVIPLGVPLDGVRAYVLDEALEPTADDAAGELYLAGHCL
ARGYHDRAALTAERFVADPFAAPGERMYRTGDRVRRAPDGTLRFLGRTDDQVKIRGHRVE
LKEVEAAVAAHPDVVDVVARAVPHQGEPQVVVYVAAVPGRALDGGVLRRDLAARVPGHLV
PARACVLPRLPRTPGGKLDVRGLPDPFAPRAAAARPPLAEPA
selected fasta
>[putative amino acid adenylating enzyme]
GTGCACCCCGACGACATCCCGGTTCCCCTGCGCATCGCACGGCAGGCGGCCCGGACACCC
GACGCCACGGCCGTGAGCGCCCCCGAGGGCGAGCTGACCTACCGCACGTTCGACCGCAGG
GCCCGTGCCGTGGCCGGGGAACTGCGCGCGGCCGGCGCGGGCCCGGAGGACACCGTGCTC
GTCGCAGTGGGCCGGGGCGCCGACTGGGCGGTGGCCGTCCTGGGCATCTGGTACGCCGGT
GCCGCGCCGCTGCTCGTCGATCCGGCGGCCCCGGACGAGCGGCTGCGCGCACTGCTGGCC
GCCGCCCGCACCCGGTACGCGGTCGTCACCGGGCACGTGGCCGCGGCCGCGCTGCGCCGC
CGGTGCGGCGAGGAGCTGTTCTGGGCCGGTACCCGGGGCGAGGCCCCGTACGCCGCCGCG
GACCCGGCCGCCGTCGCACCGGGCTCGCTGGCCTACGTCCTGTTCACCTCCGGCTCGACC
GGCAGGCCCAAACCGGTCGCCGTCGGCCACGCCGGCCTGGCCCGGCAGACCGCCGTACTC
GCCGAGCGCTACGGCCTGACCGCGGCGGACCGCGTGCTCCAGTTCGCCGCACCCGCCTTC
GACGTGTCGCTGGAGGAGGCACTGCCGACCTGGTGCACGGGCGGAACGGCCGTGTTCGTC
GACGACAACCTGGCCTCGCCCGCCGAACTGGAACCCTTCCTGGCCCGGCGCCAGGTCACC
GTCGTCAACCTGCCCACCCCCTACTGGGCCCAGTGGGCCAAGGACGTCGAACGCCGCCCC
CGGCCGCTGCCGCCCGCCCTGCGCCACGTCGTGATCGGCAGCGACGCGGGCCGCACCGCG
GACCTCGTCCGCTGGTACGCGGCCGGCGGGCCGGACGTGACCAGCGCCTACGGCCTCACC
GAGTCGACGATCACGGCCACCTGCCATGCCACGCACCCGGGTCCGTCGGCCGGCACCCCC
GACGAGGTCATCCCGCTCGGGGTGCCGCTCGACGGCGTACGGGCCTACGTCCTGGACGAG
GCGCTGGAGCCCACCGCGGACGACGCGGCGGGCGAGCTGTACCTCGCCGGGCACTGCCTG
GCACGCGGCTACCACGACCGGGCCGCCCTGACCGCCGAGCGGTTCGTCGCCGACCCGTTC
GCCGCACCGGGGGAGCGCATGTACCGCACGGGGGACCGGGTACGGCGGGCGCCCGACGGC
ACCCTGCGCTTCCTGGGCCGCACCGACGACCAGGTCAAGATCCGCGGGCACCGGGTGGAG
CTCAAGGAGGTCGAGGCGGCCGTCGCCGCCCACCCGGACGTGGTGGACGTCGTCGCCCGC
GCCGTGCCGCACCAGGGCGAACCGCAGGTGGTGGTCTACGTCGCCGCCGTCCCCGGACGG
GCCCTGGACGGTGGTGTGTTGCGCCGGGACCTGGCCGCGCGGGTGCCGGGCCACCTCGTC
CCGGCCCGGGCGTGCGTCCTGCCCCGTCTGCCGCGCACCCCGGGTGGCAAGCTCGACGTG
CGCGGCCTGCCGGACCCGTTCGCGCCGCGGGCGGCCGCCGCACGACCGCCGCTCGCCGAA
CCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [33-438]  6.20000000000009e-96 PF00501
PF00501   AMP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [33-438]  8.60000000000004e-114 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [153-164]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit