close all open/close all

CDS information : Kirro_00560


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction128,736 / 130,043 / + [in whole cluster]
128,736 / 130,043 / + [in contig]
Location128736..130043 [in whole cluster]
128736..130043 [in contig]
TypeCDS
Length1,308 bp (435 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative major facilitator family transporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative major facilitator family transporter]
MSQPTTAPDPAAGADIAAPPEGAEPSARQRRDFRRFMASHVCNELGSSITYVALPLTAVL
TLHASAWEAGVLAAAENAAFLLLGLPAGAWVDRMRRRDVMIAADLARAVLLTVVPVAWLL
DADSMPLLYTVALLLGCARLFGDVADQSYLPTLVGQSRLIQGNSRLESVRSGAEVAGPGV
AGFFVQLLGPAGTLVGQAVTSLTSVALLGRIEAREERPAPRPSGHGGLWQEIKEGLQHVL
HHRVLRVIALGTASVNLCLSGVFALETLFLTRTVGLPPAAVGWILTTASLGSVLAALVTR
RLSMRVGAARLTWLSLLVTMPFGLLLPLAGPGWRVGLFVMGVLVQSAGVTTYNICQVAYR
QTVCPPHLLGRMTATMRFLVWGVLPLSGLLAGALGELAGVRTALWILTAGLAATPLVLLC
SPLRRMRDFDAAPAQ
selected fasta
>[putative major facilitator family transporter]
GTGTCCCAGCCCACCACCGCCCCCGATCCCGCCGCCGGCGCGGACATCGCCGCCCCGCCG
GAGGGTGCCGAACCCTCCGCGCGGCAGCGGCGCGACTTCCGCCGCTTCATGGCCTCGCAC
GTGTGCAACGAACTCGGCAGCAGCATCACGTACGTGGCGCTGCCCCTGACGGCCGTGCTC
ACCCTGCACGCTTCCGCCTGGGAGGCCGGTGTGCTCGCCGCCGCCGAGAACGCGGCGTTC
CTGCTGCTCGGGCTGCCCGCCGGCGCCTGGGTCGACCGGATGCGCCGCCGCGATGTCATG
ATCGCCGCCGATCTGGCGCGGGCCGTGCTGCTCACGGTCGTGCCGGTGGCCTGGCTGCTG
GACGCCGACTCCATGCCGCTGCTGTACACCGTCGCCCTGCTGCTCGGCTGCGCGCGGCTG
TTCGGCGACGTGGCCGACCAGAGTTATCTGCCCACGCTGGTCGGCCAGTCCCGGCTGATC
CAGGGCAACTCCCGTCTGGAGAGCGTCCGGTCGGGTGCGGAGGTGGCGGGCCCCGGGGTG
GCGGGCTTCTTCGTGCAGCTCCTCGGCCCGGCCGGCACCCTGGTCGGGCAGGCCGTCACC
TCCCTCACCTCCGTGGCCCTGCTGGGCCGGATCGAGGCACGGGAGGAACGGCCCGCCCCG
CGGCCGTCCGGGCACGGCGGCCTGTGGCAGGAGATCAAGGAGGGGCTGCAGCACGTCCTG
CACCACCGCGTGCTGCGGGTCATCGCGCTCGGTACGGCCTCGGTCAACCTCTGCCTCAGC
GGCGTCTTCGCCCTGGAGACGCTCTTCCTGACCCGCACCGTGGGCCTGCCGCCCGCGGCG
GTCGGCTGGATCCTCACCACGGCCTCGCTCGGCTCGGTCCTCGCCGCGCTCGTCACGCGC
CGGCTCTCCATGAGGGTGGGCGCGGCCCGGCTGACCTGGCTGTCCCTGCTGGTCACCATG
CCCTTCGGTCTGCTGCTGCCGCTGGCCGGACCGGGCTGGCGGGTGGGCCTGTTCGTCATG
GGCGTCCTGGTGCAGTCGGCGGGGGTGACCACGTACAACATCTGCCAGGTCGCCTACCGG
CAGACCGTCTGCCCGCCGCACCTGCTCGGCCGGATGACCGCCACCATGAGGTTCCTGGTG
TGGGGAGTGCTGCCCTTGAGCGGCCTGCTGGCCGGTGCCCTCGGCGAACTGGCGGGAGTG
CGCACGGCGTTGTGGATCCTGACGGCCGGACTGGCGGCCACCCCGCTCGTCCTGCTGTGT
TCACCCCTGCGGCGGATGCGGGACTTCGACGCTGCCCCGGCTCAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010290 Major facilitator superfamily, enterobactin exporter EntS (Family)
 [31-434]  1.4e-22 PF05977
PF05977   MFS_3
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [24-427]  5.40001756046195e-43 SSF103473
SSF103473   MFS_gen_substrate_transporter
SignalP No significant hit
TMHMM
 [37-59]  Transmembrane (i-o) [69-91]  Transmembrane (o-i) [247-269]  Transmembrane (i-o) [279-298]  Transmembrane (o-i) [311-330]  Transmembrane (i-o) [335-357]  Transmembrane (o-i) [378-400]  Transmembrane (i-o) [404-423]  Transmembrane (o-i)
Transmembrane 8