close all open/close all

CDS information : Kirro_00570


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction130,366 / 130,037 / - [in whole cluster]
130,366 / 130,037 / - [in contig]
Locationcomplement(130037..130366) [in whole cluster]
complement(130037..130366) [in contig]
TypeCDS
Length330 bp (109 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative LuxR family regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative LuxR family regulator]
MNTGLSSKETLSRAFSAVTVPVTPRKPSPTSPESAMSATDPSALTLSPREQEVLAHLAQG
CTYRIIARRMGLSPHTVDTYVRRLRGKTGLVNRIQLAHLAFQLGYGPGY
selected fasta
>[putative LuxR family regulator]
GTGAACACCGGACTTTCCTCGAAGGAAACCCTGTCGAGAGCGTTTTCAGCCGTAACAGTT
CCCGTCACCCCCCGGAAGCCCTCCCCCACCTCGCCGGAGTCCGCGATGTCCGCGACCGAC
CCCTCCGCCCTCACGCTCTCGCCCCGCGAGCAGGAGGTCCTGGCCCACCTCGCGCAGGGC
TGCACGTACCGCATCATCGCCCGGCGCATGGGACTCAGCCCGCACACGGTCGACACCTAT
GTGCGCCGGCTGCGCGGCAAGACCGGCTTGGTCAACCGCATCCAGCTGGCGCACCTGGCC
TTCCAGTTGGGGTACGGCCCCGGCTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [60-87]  PS00622
PS00622   HTH_LUXR_1
 [39-104]  PS50043
PS50043   HTH_LUXR_2
 [46-60]  2.50000086445942e-08 PR00038 [60-76]  2.50000086445942e-08 PR00038 [76-88]  2.50000086445942e-08 PR00038
PR00038   HTHLUXR
 [43-100]  1.89999859865865e-22 SM00421
SM00421   HTH_LUXR
 [45-100]  4.1e-15 PF00196
PF00196   GerE
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [33-104]  2.90000000000001e-21 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [24-105]  5.8999880940569e-19 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-37]  0.673 Signal
Bacteria, Gram-positive   
TMHMM No significant hit