close all open/close all

CDS information : Kirro_00580


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction130,516 / 131,550 / + [in whole cluster]
130,516 / 131,550 / + [in contig]
Location130516..131550 [in whole cluster]
130516..131550 [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative LuxR family regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative LuxR family regulator]
MQNGAKVLSDLSDVDFDVYSWVLQHRTIEVDAVAGGTGRAAQEVRLSVERLLGAQLLHRS
PEDDSVAFAVAPDTAASRLAAPLEEEIRTRQREISGIREELGRFMPRYLQRRSVGDALEV
LENVEDVRGALNHASDRCRREVLTSQPGGGSRVPEAMQEALRRDEAMLRRGISIRSLYHH
TARFNGPSQAYVAAASALGAQYRTAHELFGRLIAFDRELAFIPVPDGSWGAVVIREPATV
AYLCDIFEQTWDRATPFSNAVGQGLEEVAREIHETIIRLLAAGLKDEAIARRLGMSLRTA
RRHIADIMEELGAGSRFQAGAAAAARGLLDDSRPADPAAQATTD
selected fasta
>[putative LuxR family regulator]
ATGCAAAATGGGGCAAAGGTGTTGTCGGATCTCAGTGACGTAGATTTCGACGTCTACAGC
TGGGTGCTCCAGCACCGCACGATCGAGGTGGACGCCGTCGCCGGGGGGACCGGGCGCGCC
GCGCAGGAGGTCCGGCTCAGCGTGGAGCGCCTGCTCGGCGCCCAGTTGCTGCACCGCAGC
CCGGAGGACGACTCCGTGGCCTTCGCGGTGGCGCCGGACACCGCCGCGTCCCGGCTCGCC
GCGCCGCTGGAGGAGGAGATCCGCACACGCCAGCGGGAGATCAGCGGCATCCGCGAGGAA
CTCGGGCGCTTCATGCCCCGCTACCTCCAGCGCCGTTCCGTCGGGGACGCGCTGGAGGTC
CTGGAGAACGTCGAGGACGTGCGCGGTGCGCTGAACCATGCCTCGGACCGCTGCCGCCGC
GAGGTCCTCACCAGCCAGCCCGGCGGCGGCAGCCGCGTGCCCGAGGCGATGCAGGAGGCG
CTGCGGCGGGACGAGGCCATGCTGCGTCGGGGCATCTCCATACGCAGCCTGTACCACCAC
ACCGCCCGCTTCAACGGCCCCAGTCAGGCCTATGTCGCCGCCGCCTCCGCGCTCGGCGCG
CAGTACCGCACCGCGCACGAACTCTTCGGCCGGCTCATCGCGTTCGACCGCGAACTCGCC
TTCATCCCGGTGCCGGACGGCAGTTGGGGTGCCGTGGTGATCCGGGAGCCCGCCACCGTC
GCCTATCTCTGCGACATCTTCGAGCAGACGTGGGACCGCGCCACGCCCTTCTCCAACGCC
GTCGGGCAGGGGCTGGAGGAGGTCGCCCGCGAGATCCACGAGACGATCATCCGGCTCCTC
GCGGCCGGACTGAAGGACGAGGCCATCGCGCGGCGGCTCGGCATGTCCCTGCGCACCGCG
CGCCGGCACATCGCCGACATCATGGAGGAACTCGGCGCCGGAAGCCGCTTCCAGGCGGGC
GCCGCCGCGGCGGCACGAGGCCTGCTGGACGACTCCCGGCCCGCGGACCCTGCGGCGCAG
GCCACCACGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [274-323]  2.59999946718995e-07 SM00421
SM00421   HTH_LUXR
 [275-319]  1.5e-07 PF00196
PF00196   GerE
 [261-327]  PS50043
PS50043   HTH_LUXR_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [275-328]  2.5e-12 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [276-333]  5.20000089003336e-11 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit