close all open/close all
Kirro_00580 Kirro_00580   last last

CDS information : Kirro_00590


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction131,952 / 132,479 / + [in whole cluster]
131,952 / 132,479 / + [in contig]
Location131952..132479 [in whole cluster]
131952..132479 [in contig]
TypeCDS
Length528 bp (175 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MNMPVDGPVAGLPQGGSGDRSPGLPDGPAGNHLRETALFVALHFSRAPGVLWPEHDHPLL
GDGGDGAEGRAVPPDVGLLAAQVAAATGLAARPAATGAPHGHLLVHQVAGATTWTVAGTG
EDGRDTSLRYRLRAGEVLYVPDGWSRTAEPTPAARWTVVVLCPDGPEQPVRPGTG
selected fasta
>[hypothetical protein]
ATGAACATGCCGGTCGACGGGCCAGTGGCGGGGCTTCCGCAGGGTGGTTCCGGGGACCGG
TCACCCGGTCTGCCCGACGGCCCGGCCGGGAACCACCTGCGGGAGACGGCCCTCTTCGTC
GCGCTCCACTTCAGCCGTGCCCCCGGCGTTCTGTGGCCGGAACACGATCATCCGCTCCTC
GGTGACGGAGGGGACGGCGCGGAGGGCCGTGCCGTACCCCCGGACGTGGGCCTGCTCGCC
GCCCAGGTCGCCGCCGCGACGGGTCTCGCGGCCCGCCCGGCGGCCACCGGCGCCCCGCAC
GGGCACCTGCTGGTCCATCAGGTCGCGGGCGCGACCACCTGGACCGTCGCCGGGACCGGT
GAGGACGGGCGGGACACCTCGCTCCGCTACCGCCTGCGCGCGGGTGAGGTGCTCTACGTC
CCCGACGGCTGGTCCCGCACCGCCGAGCCCACCCCCGCGGCCCGCTGGACGGTCGTCGTC
CTGTGTCCCGACGGGCCGGAGCAGCCAGTGCGACCCGGAACAGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-49]  0.038 Signal
Eukaryota   
TMHMM No significant hit
Kirro_00580 Kirro_00580   last last