close all open/close all

CDS information : Lando_00020


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction2,220 / 2,549 / + [in whole cluster]
2,220 / 2,549 / + [in contig]
Location2220..2549 [in whole cluster]
2220..2549 [in contig]
TypeCDS
Length330 bp (109 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)cyclase homolog
Gene
Gene (GenBank)lanF
EC number
Keyword
  • angucycline
Note
Note (GenBank)
  • LanF
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q9XCV6
NITE
Jado_00070
PmId
[11520231] Production of aromatic minimal polyketides by the daunorubicin polyketide synthase genes reveals the incompatibility of the heterologous DpsY and JadI cyclases. (J Nat Prod. , 2001)
ACC
Q93LY5
PmId
[12654660] Engineering anthracycline biosynthesis toward angucyclines. (Antimicrob Agents Chemother. , 2003)

close this sectionSequence

selected fasta
>putative cyclase [cyclase homolog]
MHSTLIVAKMDPASSIDVAKLFGDFDRTEMPHRMGTRRRQLFSYRGLYFHLQDFDENNGG
ELIEEAKTDPRFVAISQDLKPFIQAYDPETWRSPADAMATRFYDWTASS
selected fasta
>putative cyclase [cyclase homolog]
ATGCACAGCACTCTGATCGTGGCGAAGATGGACCCCGCGTCGAGTATCGACGTGGCCAAG
CTCTTCGGTGATTTCGACCGCACCGAAATGCCCCATCGTATGGGCACGAGGCGCCGACAG
CTCTTCTCGTACCGAGGCCTGTATTTCCATCTGCAGGACTTCGACGAGAACAACGGCGGT
GAACTCATAGAAGAAGCGAAGACCGATCCGCGATTCGTCGCCATCAGCCAGGACCTGAAG
CCTTTCATCCAGGCGTACGACCCGGAGACCTGGCGCTCCCCGGCCGACGCCATGGCCACC
CGCTTCTACGACTGGACGGCTTCCTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006765 Polyketide synthesis cyclase (Family)
 [10-107]  7.00000000000005e-43 PF04673
PF04673   Cyclase_polyket
 [2-107]  PD012644
PD012644   Polyketide_synth_cyclase
 [1-108]  5.49999999999995e-50 G3DSA:3.30.70.1090
G3DSA:3.30.70.1090   Cyclase_polyket
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-108]  1.70000295590053e-44 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit