close all open/close all

CDS information : Lando_00030


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction2,584 / 3,858 / + [in whole cluster]
2,584 / 3,858 / + [in contig]
Location2584..3858 [in whole cluster]
2584..3858 [in contig]
TypeCDS
Length1,275 bp (424 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)B-ketoacyl-ACP synthase homolog
Gene
Gene (GenBank)lanA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • LanA
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q54173
NITE
Urd_00120
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

KS3..376

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [B-ketoacyl-ACP synthase homolog]
MGRRVVVTGIGVLAPGGIGAENFWSLLSEGRTATRGITFFDPSSFRSQIAAEADFDAERS
GLSPQEIRRMDRAAQFGVVTGREALADSGLDQAGLDPYRTGVTIGSAVGATMGLDEEYRV
VSDGGRLDLVDHHQYTPQHLYNHFVPSSFSAEVAWAVGAEGPNTVVSTGCTSGIDSVGQA
VELIREGSVDVMIAGATDAPISPITMACFDAIKATTPRNDEPEHASRPFDGTRNGFVLGE
GSAVFVLEELTAARARGANIYAEIAGYASRCNAFHMTGLRPDGREMGEAIRVALDEARIN
PEAIDYINAHGSGTKQNDRHETAAFKLSLGEHAYRTPISSIKSMVGHSLGAIGSIEIAAS
LLAMENHVVPPTANLHTPDPECDLDYVPLVAREHTTDHGPDGRQRIPVGFQSAMVLARPE
RSAA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [B-ketoacyl-ACP synthase homolog]
ATGGGACGTCGTGTAGTCGTCACCGGAATCGGAGTCCTCGCACCGGGCGGCATCGGGGCC
GAGAACTTCTGGAGTCTGCTCAGCGAGGGCCGCACGGCGACGCGGGGGATCACCTTCTTC
GATCCCTCCTCGTTCCGTTCGCAGATCGCCGCCGAGGCGGACTTCGACGCCGAGCGGAGC
GGGCTGAGCCCTCAGGAGATACGGCGGATGGACCGTGCCGCCCAGTTCGGAGTGGTCACC
GGGCGCGAGGCGCTGGCGGACAGCGGACTGGACCAGGCAGGCCTGGACCCCTACCGCACC
GGAGTCACCATCGGAAGCGCGGTCGGCGCCACCATGGGCCTCGACGAGGAGTACCGGGTG
GTCAGCGACGGCGGCCGACTCGACCTCGTCGACCACCACCAGTACACCCCGCAGCACCTG
TACAACCACTTCGTGCCGAGTTCCTTCTCGGCCGAGGTGGCGTGGGCCGTGGGGGCCGAG
GGACCCAACACCGTGGTGTCCACCGGCTGCACCTCAGGCATCGACTCGGTCGGCCAGGCC
GTCGAGCTGATCCGCGAGGGCAGCGTCGACGTGATGATCGCCGGTGCGACGGACGCCCCC
ATCTCGCCGATCACCATGGCGTGCTTCGACGCGATCAAGGCGACCACGCCCCGCAACGAC
GAGCCCGAGCATGCCTCGCGGCCCTTCGACGGGACCCGCAACGGCTTCGTGCTCGGCGAG
GGTTCGGCGGTGTTCGTCCTGGAGGAGCTGACCGCCGCCCGCGCCCGTGGCGCCAACATC
TACGCGGAGATCGCCGGCTACGCCTCGCGGTGCAACGCCTTCCACATGACCGGGCTGCGC
CCCGACGGACGTGAGATGGGGGAGGCGATCCGGGTCGCGCTGGACGAGGCCCGGATCAAC
CCCGAGGCCATCGACTACATCAACGCGCACGGCTCGGGCACCAAGCAGAACGACCGGCAC
GAGACGGCCGCGTTCAAACTCAGCCTCGGCGAGCACGCCTACCGGACCCCGATCAGCTCC
ATCAAGTCGATGGTGGGTCACTCACTGGGCGCCATCGGCTCGATCGAGATCGCGGCGTCC
CTGCTCGCCATGGAGAACCACGTGGTGCCGCCCACCGCGAACCTGCACACGCCCGACCCG
GAGTGCGACCTCGACTACGTCCCGCTCGTCGCCCGTGAGCACACCACGGACCACGGTCCT
GACGGTCGGCAGCGGATTCCGGTGGGATTCCAGAGCGCGATGGTGCTGGCCCGCCCGGAG
AGGAGCGCGGCATGA
KS3..376
KS7..1128

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-252]  5.40000000000002e-63 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [261-376]  6e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-266]  5.50000000000008e-65 G3DSA:3.40.47.10 [271-396]  3.80000000000003e-44 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-258]  3.39999972437719e-67 SSF53901 [220-420]  2.19999900980707e-56 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [161-177]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-19]  0.959 Signal
Eukaryota   
 [1-20]  0.501 Signal
Bacteria, Gram-negative   
TMHMM No significant hit