close all open/close all

CDS information : Lando_00040


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction3,855 / 5,075 / + [in whole cluster]
3,855 / 5,075 / + [in contig]
Location3855..5075 [in whole cluster]
3855..5075 [in contig]
TypeCDS
Length1,221 bp (406 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)chain length factor homolog
Gene
Gene (GenBank)lanB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • LanB
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q54174
NITE
Urd_00130
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

CLF3..362

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [chain length factor homolog]
MTARVVITGNRIAAPNGFGVEDYWAATRVGKSAIGRITRFDPTQYPARLAGEIRGFDARD
HLPGRLIPQTDRMTQLALVATDSAFEDAGVKPGDIPEYDMGVVTASTAGGFEFGQNELQA
LWSKGSQHVSAYQSFAWFYAVNSGQISIRNGMRGHSAVVVSDQAGGLDAIAQARRQIRKG
SKLICSGGVDASICPWGWVAQLANGRVSTSENTERAYLPFDADASGYVPGEGGALLILED
AEAARQRGAENVYGEIAGYGSTFDPRPGSGREPRLRRAIELALADADAEPSDIGVVFADA
AGTPELDRVEAEALIEVFGAAGVPVTAPKTMTGRLYSGAAPVDVVTAVLAMREGLIPPTV
NVSLSPEYDIDLVTAQPRTARVRNALVVARGYGGFNSAMVVRGTDR
selected fasta
>polyketide synthase chain length factor subunit [chain length factor homolog]
ATGACCGCAAGAGTCGTCATCACCGGTAATCGGATTGCCGCACCCAACGGGTTCGGCGTG
GAGGACTACTGGGCCGCGACCCGCGTCGGCAAGAGCGCCATCGGCCGCATCACCCGCTTC
GACCCCACGCAGTACCCGGCCAGGCTGGCCGGTGAGATCCGGGGCTTCGACGCCCGGGAC
CACCTGCCGGGCCGACTCATTCCGCAGACCGACCGGATGACCCAACTTGCCCTGGTCGCC
ACCGACTCGGCGTTCGAGGACGCCGGCGTCAAGCCCGGTGACATTCCCGAGTACGACATG
GGTGTCGTGACCGCCAGCACGGCCGGTGGCTTCGAGTTCGGCCAGAACGAGCTGCAGGCG
CTGTGGAGCAAGGGCAGCCAGCACGTGAGCGCGTACCAGTCGTTCGCCTGGTTCTACGCG
GTCAACAGCGGCCAGATCTCCATCCGCAACGGCATGCGCGGGCACAGCGCCGTGGTCGTC
AGCGACCAGGCGGGCGGCCTCGACGCGATCGCCCAGGCGCGCCGGCAGATCCGCAAAGGC
AGCAAGCTGATCTGCTCCGGCGGCGTCGACGCCTCGATCTGCCCGTGGGGATGGGTGGCA
CAGCTCGCCAACGGGCGCGTCAGCACCAGCGAGAACACCGAGCGGGCCTATCTGCCCTTC
GACGCCGATGCTTCCGGCTACGTGCCGGGCGAGGGCGGCGCGCTGCTCATCCTGGAGGAC
GCCGAAGCCGCACGGCAGCGCGGCGCGGAGAACGTCTACGGGGAGATCGCCGGGTACGGC
TCGACCTTCGACCCCAGGCCCGGCAGCGGACGGGAACCGCGCCTGCGGCGCGCGATCGAG
CTCGCCCTCGCCGACGCCGACGCCGAACCCTCCGACATCGGCGTGGTGTTCGCGGACGCC
GCGGGTACGCCCGAGCTCGACCGCGTCGAGGCCGAGGCGCTCATCGAGGTCTTCGGGGCA
GCCGGGGTGCCCGTCACCGCGCCCAAGACGATGACCGGGCGGCTGTACTCCGGAGCCGCT
CCGGTGGACGTCGTCACGGCGGTCCTCGCCATGCGGGAGGGCCTGATCCCGCCCACCGTG
AACGTCTCGCTCTCTCCGGAGTACGACATCGACCTGGTCACCGCCCAGCCGCGCACGGCG
CGCGTCCGCAACGCTCTCGTCGTCGCCCGCGGTTACGGCGGTTTCAACTCGGCGATGGTC
GTGCGCGGCACGGACCGATGA
CLF3..362
CLF7..1086

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-243]  1.5e-56 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [253-362]  6.60000000000002e-29 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-258]  1.29999999999998e-53 G3DSA:3.40.47.10 [271-403]  2.50000000000001e-39 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-249]  1.3000049540733e-61 SSF53901 [212-404]  1.10000150671643e-49 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-25]  0.171 Signal
Bacteria, Gram-positive   
TMHMM No significant hit