close all open/close all

CDS information : Lando_00060


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction5,443 / 6,228 / + [in whole cluster]
5,443 / 6,228 / + [in contig]
Location5443..6228 [in whole cluster]
5443..6228 [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)reductase homolog
Gene
Gene (GenBank)lanD
EC number
Keyword
Note
Note (GenBank)
  • LanD
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q56166
NITE
Jado_00110
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [reductase homolog]
MSQQDQRVALVTGATSGIGQPPGCSPPRGTGCSRRGNAENVAETVKQLQLQDEGLDVDGT
ALDVRSADGVRAFVQSAVDRFGTVDVLVNNAGRSGGGVTADIADELWDDVIATNLTSVFR
MTREVLNTGGMRGKSRGRIINIASTAGKQGVVLGAPYSASKHGVVGFTKALGNELAPTGI
TVNAVCPGYVETPMAQRVRQGYAAAYNATEDAILEKFQAKIPLGRYSTPEEVAGLVGYLA
SDTAASITSQALNVCGGLGNF
selected fasta
>putative polyketide C-9 ketoreductase [reductase homolog]
ATGTCGCAGCAGGACCAGCGTGTCGCCCTCGTCACCGGAGCCACCAGCGGGATCGGCCAG
CCGCCCGGCTGCTCGCCACCCAGGGGCACCGGGTGTTCACGGCGCGGCAATGCGGAGAAC
GTGGCGGAGACCGTCAAGCAGCTGCAGCTGCAGGACGAGGGCCTCGACGTCGACGGCACC
GCTCTCGACGTGCGCTCCGCGGACGGGGTGCGGGCCTTCGTGCAGTCGGCGGTGGACCGG
TTCGGCACGGTCGACGTGCTGGTGAACAACGCGGGCCGGTCCGGTGGAGGGGTGACCGCA
GACATCGCGGACGAGCTGTGGGACGACGTGATCGCCACCAACCTCACCAGCGTCTTCCGG
ATGACGCGAGAGGTGCTCAACACCGGCGGGATGCGCGGGAAGTCCCGTGGCCGCATCATC
AACATCGCCTCCACGGCGGGTAAGCAGGGCGTGGTCCTCGGCGCCCCGTACTCGGCGTCC
AAGCACGGCGTCGTCGGCTTCACCAAGGCGCTGGGCAACGAGCTCGCGCCCACCGGCATC
ACCGTCAACGCGGTCTGCCCCGGCTACGTCGAGACGCCGATGGCCCAGCGCGTCCGCCAG
GGATACGCGGCCGCCTACAACGCGACCGAGGACGCGATCCTGGAGAAGTTCCAGGCGAAG
ATCCCGCTCGGCCGTTACTCCACGCCCGAGGAGGTCGCCGGCCTGGTCGGCTACCTGGCC
TCGGACACCGCCGCCTCCATCACCTCCCAGGCGCTCAACGTCTGCGGCGGACTCGGCAAC
TTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [32-175]  2.6e-26 PF00106
PF00106   adh_short
 [82-93]  5.90000104995095e-15 PR00080 [137-145]  5.90000104995095e-15 PR00080 [157-176]  5.90000104995095e-15 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  5.00000909915354e-47 PR00081 [82-93]  5.00000909915354e-47 PR00081 [131-147]  5.00000909915354e-47 PR00081 [157-176]  5.00000909915354e-47 PR00081 [178-195]  5.00000909915354e-47 PR00081 [222-242]  5.00000909915354e-47 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [5-258]  2.20000000000002e-68 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [144-172]  PS00061
PS00061   ADH_SHORT
SignalP No significant hit
TMHMM No significant hit