close all open/close all

CDS information : Lando_00070


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction6,276 / 7,235 / + [in whole cluster]
6,276 / 7,235 / + [in contig]
Location6276..7235 [in whole cluster]
6276..7235 [in contig]
TypeCDS
Length960 bp (319 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)cyclase homolog
Gene
Gene (GenBank)lanL
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
  • LanL
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q56167
NITE
Jado_00120
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [cyclase homolog]
MTVREVEHCDHRARPPAAEVYRLIAEVENWPRVFPPTIYVDQVERGTPGETGVSEERIRI
WATANGTAKNWTSRRTLDPQALRITFRQEVSAPPVAAMGGTWIIEPLAADESRIRLLHDY
RAIDDDPDSLKWIDEAVDRNSRSELAALKTNVELAHATEEVTFSFEDTVRINGSAKDVYD
FIDEADKWEERLPHVASVRLEEISPGLQILEMDTRTKDGHTHTTKFYRVCFSHQKIAYKQ
VTLPALMTLHTGYWTFTENEDGVTASSQHTVVLNTENITRYLGPDAGIAEAREHVQTALS
ANSRATLGLAKDYAEQQQR
selected fasta
>putative cyclase/dehydratase [cyclase homolog]
ATGACGGTCCGTGAGGTCGAGCACTGCGATCACCGTGCAAGGCCCCCCGCCGCCGAGGTC
TACCGCTTGATCGCCGAGGTGGAGAACTGGCCGCGCGTCTTCCCGCCGACCATCTACGTC
GACCAGGTCGAGCGGGGCACTCCCGGCGAGACCGGCGTGAGCGAGGAGCGCATCCGCATC
TGGGCCACCGCCAACGGCACGGCCAAGAACTGGACCTCGCGCCGCACTCTCGACCCGCAG
GCCCTGCGCATCACCTTCCGCCAGGAAGTGTCCGCGCCGCCGGTCGCGGCGATGGGCGGC
ACCTGGATCATCGAGCCGCTCGCCGCGGACGAGTCCAGGATCCGGCTGCTCCACGACTAT
CGGGCCATCGACGACGATCCCGACTCCCTGAAGTGGATCGACGAGGCCGTCGACCGCAAC
TCCCGCTCGGAGCTCGCCGCACTGAAGACCAATGTCGAACTCGCCCACGCCACCGAGGAG
GTGACGTTCTCCTTCGAGGACACCGTGCGGATCAACGGCTCCGCGAAGGACGTGTACGAC
TTCATCGACGAGGCCGACAAGTGGGAGGAGCGGTTGCCGCACGTGGCGTCCGTGCGGCTT
GAGGAGATCTCCCCGGGCCTGCAGATACTTGAGATGGACACCCGTACCAAGGACGGGCAC
ACGCACACCACCAAGTTCTACCGCGTGTGCTTCTCGCACCAGAAGATTGCGTACAAACAG
GTTACCCTGCCCGCCCTGATGACCCTGCACACCGGCTACTGGACGTTCACGGAGAACGAG
GACGGCGTCACCGCCTCCTCGCAGCACACCGTCGTGCTGAACACCGAGAACATCACCAGG
TACCTCGGCCCGGACGCCGGGATCGCCGAGGCCAGGGAACACGTGCAGACGGCCCTGAGC
GCCAACAGCCGGGCCACCCTGGGTCTCGCCAAGGACTACGCCGAGCAGCAGCAGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [16-153]  4.00000000000001e-09 PF10604 [163-276]  7.19999999999999e-06 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [16-120]  5.29999999999999e-14 G3DSA:3.30.530.20 [165-264]  5.29999999999999e-14 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit