close all open/close all

CDS information : Lando_00080


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction7,238 / 9,471 / + [in whole cluster]
7,238 / 9,471 / + [in contig]
Location7238..9471 [in whole cluster]
7238..9471 [in contig]
TypeCDS
Length2,234 bp (744 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Product2,3-dehydratase/putative oxidoreductase
Product (GenBank)oxygenase homolog
GenelanM2
lanM/lanN
Gene (GenBank)lanM
EC number
Keyword
Note
  • Re-sequencing of Landomycin gene cluster revealed that lanM and lanN encodes one intact gene lanM2.
  • It is proposed that this ORF oxygenase domain also serves as key enzyme bridging PKS and post-PKS reactions by catalyzing the hydrolysis and decarboxylation of the ACP-tethered angucycline to prejadomycin(2,3-dehydro-UWM6).
Note (GenBank)
  • LanM
Reference
ACC
PmId
[15651811] Identification of the function of gene lndM2 encoding a bifunctional oxygenase-reductase involved in the biosynthesis of the antitumor antibiotic landomycin E by Streptomyces globisporus 1912 supports the originally assigned structure for landomycinone. (J Org Chem. , 2005)
[22454092] Elucidation of post-PKS tailoring steps involved in landomycin biosynthesis. (Org Biomol Chem. , 2012)

close this sectionSequence

selected fasta
>2,3-dehydratase/putative oxidoreductase [oxygenase homolog]
MAAKHTDTQVIVVGAGPVGLMLAGELRLGGADVVVVEKLSTPTTESRASTLHARTMEILD
SRGLLDELVPVPNDVMGHFGGIPLDLTLPSAYPGQWKVPQTRVEELLQGWATGLGAVVLR
GHELRGLTVGQGHVAVDVLGPDGPVRMRGRYVVGCDGEQSAVRRLSGIAFPGEDASRELI
RADVAGIDIPPRRFQRLESGLAIAARRPDGVTRVMVHEFGRTAEPRSAEPEFSEVAEIWK
RVTGEDISGGEPLWVNAFGNASRLAERYRDGRVLLAGDAAHQQMPVGGQALNLGLQDAVN
LGWKLAAQVTGRQPDGLLDSYHTERHAVGRRTLSNIRAQSLLLLGGGEVEGVRGVFAEIT
AMEDVRTRLAGMISGLESRYEVGPGHHPLLGARVPHVELAGEQGTVTTTALLRPGRAVLI
GLSGDPLRGARLRAAATPWFPRVTVTLAEPVDHSAPLADVDAVLARPDGHVVWTGSAGEA
ELHAVLRRWFGEPEPAGTAGTRFRAHGSSTPLGADSPAGPPW*PTRAGERAVRPPCASRP
REPSSPSTTQAMSRRPTMSSGRSGRAADAPSRSARNSAGTGTSSAFSPIWKRS*RTVRVG
PIWTSWSTVPMTSTASLPSTRRRRSSTGWSRPVPRRRTSSSSGR*GASPTGAASSTSRAV
RSSRWSRRRSRTRWPRAPSRRSPGTTPWPWHHAASPSTAWRPAPRTTVNASARWWPSSQV
TTRAGSPAPCSTPTAARCTDGRPA-
selected fasta
>2,3-dehydratase/putative oxidoreductase [oxygenase homolog]
ATGGCCGCGAAGCACACCGACACCCAGGTGATCGTGGTCGGGGCGGGTCCGGTCGGGCTG
ATGCTCGCCGGCGAGCTGCGGCTCGGCGGGGCCGACGTGGTGGTCGTCGAAAAACTGTCC
ACCCCCACCACGGAATCCCGGGCGTCCACCCTGCACGCCCGCACCATGGAGATCCTCGAC
AGCAGGGGCCTGCTCGACGAGCTGGTCCCCGTTCCGAACGACGTCATGGGCCACTTCGGC
GGGATACCACTCGACCTCACCCTTCCATCGGCCTACCCCGGCCAGTGGAAGGTCCCGCAG
ACCCGTGTCGAGGAGCTGCTCCAGGGCTGGGCGACCGGCCTCGGCGCCGTCGTCCTGCGC
GGCCACGAGCTGCGTGGTCTCACGGTCGGCCAGGGCCACGTGGCCGTGGACGTCCTCGGC
CCGGACGGCCCGGTGCGGATGCGGGGACGGTACGTCGTCGGCTGCGACGGCGAGCAGAGC
GCGGTGCGCCGCCTCAGCGGCATCGCCTTCCCCGGCGAAGACGCCTCTCGCGAGCTCATC
CGCGCGGACGTGGCCGGCATCGACATCCCACCGCGCCGCTTCCAGCGCCTCGAAAGCGGA
CTCGCCATCGCCGCGCGCCGTCCCGACGGGGTGACACGCGTGATGGTGCACGAGTTCGGC
CGCACGGCCGAACCCCGCTCGGCGGAACCTGAGTTCAGCGAGGTCGCCGAGATCTGGAAG
CGTGTCACCGGCGAGGACATCAGTGGCGGCGAGCCGCTCTGGGTCAACGCCTTCGGCAAC
GCGTCACGACTGGCGGAGCGGTACCGGGACGGCAGGGTTCTGCTGGCGGGCGATGCCGCC
CACCAGCAGATGCCGGTCGGCGGCCAGGCACTCAACCTGGGCCTGCAGGACGCGGTGAAC
CTCGGCTGGAAACTGGCCGCGCAAGTCACCGGACGGCAGCCGGACGGGCTCCTGGACAGC
TACCACACCGAACGGCACGCGGTCGGACGGCGCACGCTGAGCAACATCAGGGCACAGTCC
CTGCTGCTGCTCGGGGGTGGCGAAGTGGAGGGCGTCCGGGGGGTGTTCGCCGAGATCACG
GCCATGGAGGACGTGCGCACCCGCCTGGCCGGAATGATCTCCGGCCTGGAATCCCGCTAC
GAGGTGGGACCGGGTCACCATCCGCTGCTCGGTGCCCGCGTCCCCCACGTGGAACTGGCG
GGTGAGCAAGGTACGGTCACCACCACCGCCCTGCTCAGGCCGGGCCGCGCGGTGCTGATC
GGCCTGTCCGGTGATCCGCTCCGGGGGGCGCGGCTGCGCGCCGCGGCCACCCCGTGGTTC
CCGAGGGTCACCGTGACCCTGGCCGAACCTGTCGACCACTCGGCCCCGTTGGCGGACGTC
GACGCCGTTCTCGCACGGCCGGACGGTCATGTCGTATGGACCGGCAGTGCGGGAGAAGCG
GAACTGCACGCCGTGCTGCGCCGCTGGTTCGGCGAACCGGAGCCCGCCGGAACGGCCGGG
ACCCGGTTCCGGGCCCACGGTTCGTCCACACCGTTGGGGGCGGACTCGCCGGCAGGACCG
CCCTGGTGACCCACGCGGGCGGGGGAGCGGGCCGTGCGGCCGCCATGCGCCTCGCGGCCG
CGGGAGCCCTCGTCGCCATCCACCACACAGGCGATGAGCAGGCGGCCGACGATGTCGTCC
GGGCGATCGGGGAGGGCGGCGGATGCGCCTTCGCGCTCGGCGCGGAACTCGGCGGGTACG
GGAACGTCCAGCGCCTTTTCGCCGATCTGGAAGCGGAGCTGACGGACCGTACGGGTAGGG
CCGATCTGGACATCCTGGTCAACAGTGCCGATGACGTCGACGGCGTCGCTCCCGAGCACG
CGACGCCGGAGGAGTTCGACCGGCTGGTCGCGGCCGGTGCCAAGGCGCCGTACTTCGTCA
TCCAGCGGGCGCTGAGGAGCCTCGCCGACGGGGGCCGCGTCATCAACATCTCGCGCGGTG
CGGTCGAGCCGGTGGAGCCGAAGGCGGTCGCGTACGCGATGGCCAAGGGCGCCGTCGAGA
CGCTCGCCCGGCACTACGCCGTGGCCTTGGCACCACGCGGCATCACCGTCAACAGCGTGG
CGCCCGGCACCACGGACGACGGTGAACGCGTCGGCACGGTGGTGGCCTTCCTCGCAGGTG
ACGACGCGGGCGGGATCACCGGCGCCGTGTTCGACGCCGACGGCAGCCCGGTGCACGGAC
GGCCGGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [519-688]  1.3e-11 PF00106
PF00106   adh_short
IPR002938 Monooxygenase, FAD-binding (Domain)
 [7-333]  2.90000000000003e-77 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [9-31]  7.2000271977897e-38 PR00420 [148-163]  7.2000271977897e-38 PR00420 [270-285]  7.2000271977897e-38 PR00420 [285-301]  7.2000271977897e-38 PR00420 [303-321]  7.2000271977897e-38 PR00420 [321-337]  7.2000271977897e-38 PR00420
PR00420   RNGMNOXGNASE
IPR016040 NAD(P)-binding domain (Domain)
 [514-734]  1.9e-40 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-31]  0.281 Signal
Eukaryota   
TMHMM No significant hit