close all open/close all

CDS information : Lando_00100


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction9,626 / 10,207 / + [in whole cluster]
9,626 / 10,207 / + [in contig]
Location9626..10207 [in whole cluster]
9626..10207 [in contig]
TypeCDS
Length582 bp (193 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)reductase homolog
Gene
Gene (GenBank)lanO
EC number
Keyword
Note
Note (GenBank)
  • LanO
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q9ZGB0
NITE
Lando_00300
PmId
[15812784] Generation of novel landomycins M and O through targeted gene disruption. (Chembiochem. , 2005)
[22454092] Elucidation of post-PKS tailoring steps involved in landomycin biosynthesis. (Org Biomol Chem. , 2012)
ACC
Q6T1C6
PmId
[15123249] Generation of new landomycins by combinatorial biosynthetic manipulation of the LndGT4 gene of the landomycin E cluster in S. globisporus. (Chem Biol. , 2004)
ACC
Q07923
PmId
[15184374] Crystal structure and functional characterization of yeast YLR011wp, an enzyme with NAD(P)H-FMN and ferric iron reductase activities. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>putative oxidoreductase [reductase homolog]
MSQEPLRLALIIGSNREARFGEVVGDWFAGVAKRRGDLTVDVIDLADHELPTVLSQNPSP
RVAAELEKVSPRLAEADAYVVVTPEYNHSYPAALKNLIDWHHTQWQAKPVGFVSYGGLSG
GLRSVEHLRPVFAELHAVTVRDVVSLHMAWERFGPDGAPKDEGPAQAAKVLLDQLVWWGN
ALREARAKTPYGI
selected fasta
>putative oxidoreductase [reductase homolog]
ATGTCGCAGGAGCCCCTCCGCCTTGCCTTGATCATCGGCAGCAACCGCGAAGCCCGCTTC
GGAGAGGTCGTCGGCGACTGGTTCGCCGGCGTGGCGAAGCGCCGCGGGGATCTCACCGTC
GACGTGATCGACCTCGCGGACCACGAGCTGCCCACGGTGCTGTCGCAGAACCCTTCGCCC
CGGGTCGCGGCCGAGCTGGAAAAGGTCTCGCCGCGCCTCGCCGAAGCGGATGCCTACGTG
GTGGTGACGCCGGAGTACAACCACAGCTACCCGGCCGCGCTGAAGAACCTCATCGACTGG
CACCACACCCAGTGGCAGGCCAAGCCGGTCGGCTTCGTCTCCTACGGCGGCCTGTCGGGC
GGCCTTCGCTCCGTCGAGCACCTGCGGCCGGTCTTCGCCGAGCTGCACGCGGTGACCGTC
CGTGACGTGGTCAGCCTCCACATGGCGTGGGAGCGGTTCGGTCCGGACGGCGCCCCCAAG
GACGAGGGCCCCGCCCAGGCCGCGAAGGTGCTGCTCGACCAGCTCGTCTGGTGGGGCAAC
GCCCTGCGCGAGGCTCGTGCCAAGACCCCGTACGGAATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005025 NADPH-dependent FMN reductase (Domain)
 [7-151]  4.30000000000003e-42 PF03358
PF03358   FMN_red
SignalP No significant hit
TMHMM No significant hit