close all open/close all

CDS information : Lando_00120


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction12,086 / 13,153 / + [in whole cluster]
12,086 / 13,153 / + [in contig]
Location12086..13153 [in whole cluster]
12086..13153 [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)NDP-hexose synthetase homolog
Gene
Gene (GenBank)lanG
EC number2.7.7.24
Keyword
Note
Note (GenBank)
  • LanG
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
[16039521] Iteratively acting glycosyltransferases involved in the hexasaccharide biosynthesis of landomycin A. (Chem Biol. , 2005)
Related Reference
ACC
Q2HR55
NITE
Sch475_00270
PmId
[18051285] Cloning and expression of glucose-1-phosphate thymidylyltransferase gene (schS6) from Streptomyces sp. SCC-2136. (J Microbiol Biotechnol. , 2007)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-hexose synthetase homolog]
MKALVLSGGSGTRLRPFSHSMPKQLIPIANKPVLEHVLRNVRDLGVTEIGVIVGDRAEQI
QAVIGDGSALGVEITYIPQEAPLGLAHCVELARPFLGDDDFVMYLGDNMLPEGVERIADE
FTAGRPAAQVVVHKVPDPRAFGVAELAADGRVERLVEKPQEPKSDLALIGVYFFTPAIHK
AVAAIEPSARGELEITDAIQWLVANGDRFKANEYKGYWKDTGRIEDVLECNRKLLDDLKP
ATEGEVDAASTLIGTVVVEAGPKSSAPAIEGPVVIGAGSVVKDSHIGPHTSIGRDVRLTG
TSIEYSIALDDATISHVRDLHSSVIGRSASVGPSDRSTRHHRLVVGDHTRVEVAA
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-hexose synthetase homolog]
ATGAAGGCTCTGGTCCTGTCGGGCGGGTCGGGAACCCGGTTGCGCCCCTTCAGCCACTCG
ATGCCGAAACAGCTCATACCGATCGCCAACAAGCCGGTCCTGGAGCACGTCCTCCGGAAC
GTCAGGGACCTCGGCGTGACGGAGATCGGCGTCATCGTCGGCGACCGCGCCGAGCAGATC
CAGGCGGTCATCGGCGACGGCTCCGCGCTCGGCGTGGAGATCACCTACATCCCGCAGGAG
GCGCCGCTCGGCCTCGCCCACTGCGTGGAACTCGCCCGGCCCTTCCTCGGCGACGACGAC
TTCGTGATGTACCTCGGCGACAACATGCTGCCCGAAGGCGTCGAGCGGATCGCCGACGAG
TTCACGGCCGGCCGCCCGGCCGCCCAGGTCGTGGTCCACAAGGTGCCGGACCCGCGTGCC
TTCGGGGTCGCCGAGCTGGCCGCGGACGGCAGGGTCGAGCGCCTGGTGGAGAAGCCGCAG
GAGCCCAAGAGCGATCTCGCGCTCATCGGCGTCTACTTCTTCACCCCGGCGATCCACAAG
GCCGTTGCCGCCATCGAGCCGAGCGCTCGCGGCGAACTGGAGATCACCGACGCCATCCAG
TGGCTCGTCGCCAACGGCGACAGGTTCAAGGCCAACGAGTACAAGGGCTACTGGAAGGAC
ACCGGACGCATCGAGGACGTCCTGGAGTGCAACCGGAAGCTCCTGGACGACCTGAAGCCG
GCCACCGAGGGCGAGGTCGACGCGGCAAGCACGCTCATCGGCACGGTCGTGGTGGAAGCG
GGTCCAAAGTCATCGGCTCCCGCTATCGAGGGCCCCGTCGTGATCGGCGCCGGATCGGTG
GTGAAGGACAGCCACATCGGCCCGCACACCTCCATCGGCAGGGACGTCCGGCTGACCGGC
ACGAGCATCGAGTACTCGATCGCACTGGACGACGCCACCATCTCCCACGTCCGCGACCTG
CACAGCTCCGTCATCGGGCGCTCCGCGTCGGTCGGTCCCTCCGACCGGAGCACCCGCCAT
CACCGGCTCGTCGTCGGTGACCACACCCGAGTCGAGGTAGCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-236]  5.19999999999996e-55 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-352]  2.59999999999995e-123 TIGR01208
TIGR01208   RmlA_long
IPR011004 Trimeric LpxA-like (Domain)
 [269-351]  5.99999702863249e-06 SSF51161
SSF51161   Trimer_LpxA_like
SignalP No significant hit
TMHMM No significant hit