close all open/close all

CDS information : Lando_00130


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction13,150 / 14,130 / + [in whole cluster]
13,150 / 14,130 / + [in contig]
Location13150..14130 [in whole cluster]
13150..14130 [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)NDP-hexose 4,6-dehydratase homolog
GenelanH
Gene (GenBank)lanH14
EC number4.2.1.46
Keyword
Note
Note (GenBank)
  • LanH
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q56173
NITE
Grana_00110
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [NDP-hexose 4,6-dehydratase homolog]
MKKILITGGAGFIGSHYVRTLLNDGYEDWKGAHVTVLDKLTYAGNRDNLPEAHPRLTFVQ
GDICDFELLLELLPGHDAVVHFAAESHVDRSLESAEEFVHTNVTGTQRLLDAVLATRVKR
VVHVSTDEVYGSIDEGSWTEEWPLAPNSPYSASKAASDLLARSYWRTHGLDLSITRCSNN
YGPYQHPEKLIPLFVTNLLEGEQVPLYGDGGNIREWLHVDDHCRAIDLVLNKGRAGEIYN
IGGGNEQTNRAITERLIALTGQDWSKVRHVPDRKAHDLRYSLDESKIREELGYAPRITFE
QGLADTVAWYHDNPGWWKGTKHNKQG
selected fasta
>putative dTDP-glucose 4,6-dehydratase [NDP-hexose 4,6-dehydratase homolog]
ATGAAGAAGATCCTGATCACCGGTGGCGCGGGCTTCATCGGTTCGCACTACGTGCGCACC
CTCCTGAACGACGGCTACGAGGACTGGAAGGGCGCCCACGTCACCGTCCTCGACAAGCTC
ACCTACGCCGGCAACCGCGACAACCTGCCCGAGGCGCACCCGCGCCTGACCTTCGTCCAG
GGCGACATCTGCGACTTCGAGCTGCTGCTCGAACTGCTGCCGGGACACGACGCGGTCGTC
CACTTCGCCGCCGAGTCGCACGTGGACCGCTCTCTGGAGTCCGCGGAGGAGTTCGTCCAC
ACCAACGTCACCGGCACCCAGCGACTGCTCGACGCGGTGCTCGCCACCCGAGTCAAGCGC
GTCGTCCACGTCTCCACCGACGAGGTCTACGGCTCCATCGACGAGGGATCCTGGACCGAG
GAGTGGCCGCTGGCGCCCAACTCCCCGTACTCCGCCTCCAAGGCCGCGTCCGACCTGCTC
GCACGCTCGTACTGGCGCACCCACGGCCTCGACCTCTCCATCACCCGGTGCTCCAACAAC
TACGGCCCGTACCAGCACCCGGAGAAGCTCATCCCGCTGTTCGTCACCAACCTGCTGGAG
GGTGAGCAGGTGCCGCTCTACGGCGACGGCGGCAACATCCGCGAGTGGCTGCACGTCGAC
GACCACTGCCGTGCGATCGACCTCGTCCTCAACAAGGGCCGGGCCGGGGAGATCTACAAC
ATCGGCGGCGGCAACGAGCAGACGAACCGGGCCATCACCGAGCGGCTCATCGCTCTGACG
GGACAGGACTGGTCCAAGGTCCGTCACGTCCCCGACCGCAAGGCGCACGACCTGCGCTAC
TCCCTCGACGAGTCGAAGATCCGCGAAGAGCTCGGCTACGCCCCGCGCATCACCTTCGAG
CAGGGCCTCGCCGACACCGTCGCCTGGTACCACGACAACCCCGGCTGGTGGAAGGGGACC
AAGCACAACAAGCAGGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [4-242]  8.1e-72 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [3-318]  2.19999999999997e-130 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-189]  2.59999999999995e-70 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit