close all open/close all

CDS information : Lando_00140


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction14,216 / 15,520 / + [in whole cluster]
14,216 / 15,520 / + [in contig]
Location14216..15520 [in whole cluster]
14216..15520 [in contig]
TypeCDS
Length1,305 bp (434 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase
Product (GenBank)NDP-hexose 3,4-dehydratase homolog
Gene
Gene (GenBank)lanQ
EC number
Keyword
  • L-rhodinose
Note
Note (GenBank)
  • LanQ
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q9ALN8
NITE
Spino_00050
PmId
[17076492] Characterization of SpnQ from the spinosyn biosynthetic pathway of Saccharopolyspora spinosa: mechanistic and evolutionary implications for C-3 deoxygenation in deoxysugar biosynthesis. (J Am Chem Soc. , 2006)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase [NDP-hexose 3,4-dehydratase homolog]
MSVHRKLVLDEVRKYHQDTQGDGVFVPGTTEIWPSGAVLDEDDRIALVEAALEMRIAAGR
SSRKFESSFARKMKRRKAHLTNSGSSANLLATTALTSHLLEDRRLRPGDEVITVAAGFPT
TVNPILQNGLIPVFVDVELGTYKTTADRVAQAIGPKTRAIIIAHTLGNPFEVAEIAQLAV
DHDLFLIEDNCDAVGSTYDGKLTGTFGELTTVSFYPAHHLTMGEGGCVLTADLALARIVE
SLRDWGRDCWCEPGESDKCLKRFKYQMGTLPAGYDHKYIFSHVGYNLKATDLQAALGLTQ
LAKLDDFVEARKRNWRRLRDGLDGVPHLLLPEATPRRHPSWFGFVLTVSPDAPFKRAELV
DFLEGRKIGTRRLFAGNLTRHPAYIDQPHRVVGNLDNSDIITEQTFWVGVYPGLTDEMLD
YVISSVKEFVEARG
selected fasta
>putative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase [NDP-hexose 3,4-dehydratase homolog]
ATGAGCGTGCACAGGAAACTTGTGCTCGACGAGGTCCGCAAGTACCACCAGGACACCCAG
GGCGACGGCGTGTTCGTTCCCGGCACCACGGAGATCTGGCCGTCCGGAGCGGTGCTCGAC
GAGGACGACCGGATCGCTCTCGTCGAGGCAGCCCTGGAGATGCGCATCGCGGCCGGCCGC
AGCTCTCGCAAGTTCGAGTCGTCCTTCGCCCGCAAGATGAAACGGCGCAAGGCCCACCTC
ACCAACTCCGGCTCCTCGGCGAACCTGCTCGCGACGACGGCTCTGACCTCACACCTCCTG
GAGGACCGCAGGCTGCGGCCCGGCGACGAGGTCATCACCGTGGCGGCGGGCTTCCCCACC
ACGGTCAACCCGATCCTGCAGAACGGCCTCATTCCGGTTTTCGTCGACGTCGAACTCGGC
ACCTACAAAACGACAGCGGACCGCGTCGCCCAGGCCATCGGTCCGAAGACCCGGGCGATA
ATTATTGCGCACACGCTCGGCAACCCCTTCGAAGTCGCCGAGATCGCCCAACTCGCCGTC
GACCACGACCTGTTCCTCATCGAGGACAACTGCGACGCGGTCGGTTCGACGTACGACGGC
AAACTCACCGGTACCTTCGGTGAGCTGACCACCGTCAGCTTCTACCCGGCCCACCACCTC
ACGATGGGCGAGGGCGGCTGCGTCCTGACGGCGGACCTGGCACTCGCCCGGATCGTCGAG
TCCCTGCGTGACTGGGGTCGCGACTGCTGGTGCGAGCCCGGTGAGAGCGACAAGTGCCTC
AAGCGGTTCAAGTACCAGATGGGCACCCTGCCGGCCGGCTACGACCACAAGTACATCTTC
TCGCACGTCGGTTACAACCTGAAGGCCACCGATCTGCAGGCGGCGCTCGGCCTCACCCAG
CTCGCCAAGCTCGACGACTTCGTCGAGGCACGCAAGCGCAACTGGCGGCGGCTGCGCGAC
GGCCTGGACGGCGTCCCGCACCTCCTGCTGCCCGAGGCCACACCGCGCAGGCACCCGAGT
TGGTTCGGCTTCGTGCTCACCGTCAGTCCGGACGCCCCCTTCAAGCGCGCGGAGCTGGTG
GACTTCCTGGAGGGCCGCAAGATCGGCACCCGGCGTCTCTTCGCCGGCAACCTCACCCGG
CACCCCGCCTACATCGACCAGCCCCACCGGGTCGTCGGCAACCTCGACAACAGCGACATC
ATCACCGAGCAGACCTTCTGGGTGGGCGTCTACCCGGGCCTGACCGACGAGATGCTCGAC
TACGTGATCTCCTCGGTGAAGGAATTCGTGGAGGCCCGCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [2-434]  1.09999184471405e-109 PIRSF000390
PIRSF000390   PLP_StrS
 [41-426]  8.70000000000003e-97 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [32-302]  2.30000000000004e-67 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [303-427]  1.6e-49 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [29-433]  6.10002656149838e-92 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit