close all open/close all

CDS information : Lando_00150


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction15,517 / 16,278 / + [in whole cluster]
15,517 / 16,278 / + [in contig]
Location15517..16278 [in whole cluster]
15517..16278 [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)4-keto reductase homolog
Gene
Gene (GenBank)lanR
EC number
Keyword
  • D-olivose
Note
Note (GenBank)
  • LanR
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q9L4S5
NITE
Urd_00250
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [4-keto reductase homolog]
MTMEIVGNGFLARNLHPYADRHPDTVAVAAGVSWASGTSDADFAREAALLADVAVRCRAT
GRRLLFFSTAATGMYGAMDGPGREDSHIVPCTPYGAHKFALEQQLRASGADYLILRLGHL
VGPGQPAHQLIPALIRQMREGDVRVQRDAARDLIDVRDVVTVIDRLLAQGLRGEIVNVAS
GVAVPVGHIVDHLEERLGLRVNRAYQDAGAQHDISIDKLRSLVPETAAMGFGPFYYRQVL
DAFLASEGASSGV
selected fasta
>putative NDP-hexose C-4 ketoreductase [4-keto reductase homolog]
ATGACCATGGAGATCGTGGGCAACGGCTTCCTCGCCAGGAACCTGCACCCGTACGCGGAC
CGTCACCCGGACACCGTCGCGGTGGCGGCCGGCGTCTCCTGGGCGAGCGGCACCTCCGAC
GCCGACTTCGCCCGCGAGGCCGCGTTGCTCGCCGACGTCGCCGTCCGGTGCCGTGCCACC
GGACGGCGTCTGCTCTTCTTCTCCACCGCGGCCACCGGCATGTACGGCGCCATGGACGGG
CCGGGGCGGGAGGACAGCCACATCGTGCCCTGCACCCCTTATGGAGCCCACAAGTTCGCC
CTGGAGCAGCAGCTGCGGGCCAGCGGCGCCGACTACCTGATTCTGCGTCTCGGTCATCTC
GTCGGCCCCGGTCAGCCCGCGCACCAGCTGATTCCTGCCCTGATCCGGCAGATGCGCGAA
GGCGATGTGCGCGTGCAGCGCGACGCGGCCCGCGACCTGATCGACGTACGCGACGTCGTC
ACGGTCATCGACCGGCTGCTCGCCCAGGGCCTGCGCGGCGAGATCGTCAACGTGGCATCC
GGCGTGGCGGTCCCCGTGGGACACATCGTCGACCACCTGGAGGAACGGCTCGGCCTGCGG
GTGAACAGGGCGTACCAGGACGCCGGCGCCCAGCACGACATCTCCATCGACAAACTGCGC
TCCCTCGTCCCGGAGACCGCCGCGATGGGCTTCGGCCCCTTCTACTACCGTCAGGTCCTC
GACGCGTTCCTCGCGTCGGAGGGCGCATCGTCCGGGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [20-179]  1.3e-24 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [22-196]  3.09999999999998e-19 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit