close all open/close all

CDS information : Lando_00160


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction16,318 / 17,727 / + [in whole cluster]
16,318 / 17,727 / + [in contig]
Location16318..17727 [in whole cluster]
16318..17727 [in contig]
TypeCDS
Length1,410 bp (469 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)NDP-hexose 2,3-dehydratase homolog
Gene
Gene (GenBank)lanS
EC number
Keyword
  • D-olivose
  • L-rhodinose
Note
Note (GenBank)
  • LanS
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-hexose 2,3-dehydratase homolog]
MLSSLVRTGSGTGRLRPRHDPSVAERIAASAAAVTGASLRTEDFPQWLEGRRRAHRFTVD
RIPFDALDGWSFDDATGNLVHRSGRFFSVEGLHVTRDEGPHREWYQPIIKQPEVGILGIL
VKEFDGVLHFLMQAKMEPGNRNLLQLSPTVQATRSNYTKVHKGADVKYIEYFTQPGRGRF
IADVLQSEHGSWFFHKSNRNMIVEAVGDVPLDDDFCWLTLGQIGQLLHRDNVVNMDSRTV
LACAPFPDDGADALLSDTELVSWFTAERSRHDVRAERVPLHDLPGWVRGTSTIDHELGRY
FRVVAVSVEAGSREVTGWTQPLFEPLGLGVTAFLTRRIGGVPHVLVHARVEGGFLDTVEL
GPTVQYTPDNYGHLTGEDRPPFLDLVLDADPARIQYEAVHSEEGGRFLNAESRYLLIEAD
EEQAPLDPPAGFQWVTPAQLTSLVRHGHYVNVQARTLLACLNATAVLSG
selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-hexose 2,3-dehydratase homolog]
GTGCTTTCCTCCCTTGTCAGGACTGGATCCGGGACCGGTCGGCTGCGGCCGCGCCACGAC
CCCTCGGTCGCCGAGCGCATCGCCGCGTCGGCCGCCGCCGTCACGGGCGCGAGCCTGCGC
ACCGAGGACTTCCCGCAGTGGCTCGAAGGGCGCCGAAGGGCCCATCGGTTCACCGTGGAC
CGGATCCCCTTCGATGCGCTCGACGGCTGGTCCTTCGACGACGCCACCGGCAACCTGGTG
CACCGCAGCGGCCGGTTCTTCTCCGTCGAGGGACTGCACGTCACCCGGGACGAAGGGCCG
CACCGCGAGTGGTACCAGCCCATCATCAAGCAGCCCGAGGTCGGGATCCTCGGCATTCTC
GTCAAGGAGTTCGACGGGGTGCTGCACTTCCTCATGCAGGCCAAGATGGAGCCGGGCAAC
CGCAACCTGCTGCAGCTCTCGCCGACCGTGCAGGCCACCCGGAGCAACTACACCAAGGTC
CACAAGGGCGCCGATGTGAAGTACATCGAGTACTTCACCCAGCCCGGCCGCGGGCGGTTC
ATCGCCGATGTGCTGCAGTCCGAGCACGGATCGTGGTTCTTCCACAAGAGCAACCGCAAC
ATGATCGTCGAGGCCGTCGGCGACGTGCCGCTCGACGACGACTTCTGCTGGCTCACCCTC
GGCCAGATAGGCCAGCTCCTGCACCGCGACAATGTCGTGAACATGGACTCGCGCACGGTC
CTCGCCTGCGCTCCGTTCCCCGACGACGGGGCGGACGCCCTGCTCTCGGACACCGAACTC
GTCTCGTGGTTCACCGCCGAGCGCTCCCGGCACGACGTGCGCGCCGAGCGCGTCCCGCTC
CACGACCTCCCCGGCTGGGTCCGCGGCACGTCGACCATCGATCACGAGCTGGGCCGGTAC
TTCCGCGTCGTCGCCGTCTCCGTGGAGGCGGGCAGCCGCGAGGTCACCGGCTGGACCCAG
CCCCTGTTCGAGCCCCTTGGCCTCGGCGTCACCGCCTTCCTGACCCGGCGGATCGGCGGC
GTGCCGCACGTCCTGGTGCACGCGCGCGTGGAGGGCGGCTTCCTCGACACCGTCGAGCTC
GGCCCCACCGTCCAGTACACGCCGGACAACTACGGGCACCTGACCGGCGAGGACCGGCCG
CCCTTCCTCGACCTGGTCCTCGACGCCGACCCGGCCCGCATCCAGTACGAGGCCGTCCAC
TCGGAGGAAGGCGGCCGCTTCCTCAACGCGGAGAGCCGATACCTTCTGATCGAGGCCGAC
GAGGAGCAGGCCCCGTTGGACCCGCCCGCCGGTTTCCAGTGGGTCACGCCCGCCCAGCTC
ACTTCCCTCGTACGGCACGGCCACTACGTGAACGTCCAGGCCCGAACCCTGCTCGCCTGC
CTCAACGCGACGGCGGTGCTCTCCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [41-243]  4.30000000000003e-88 PF03559 [256-461]  6.90000000000007e-84 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit