close all open/close all

CDS information : Lando_00170


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction17,724 / 18,689 / + [in whole cluster]
17,724 / 18,689 / + [in contig]
Location17724..18689 [in whole cluster]
17724..18689 [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)oxidoreductase homolog
Gene
Gene (GenBank)lanT
EC number
Keyword
  • D-olivose
  • L-rhodinose
Note
Note (GenBank)
  • LanT
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q9ALN5
NITE
Spino_00080
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [oxidoreductase homolog]
MKTVRIGVLGCADIARRRMLPAMAAEPGITIAAVASRDSARAGELAGRFGARPVTGYAEL
LERDDIDAVYVPLPAALHARWTEAALRRGKHVLAEKPLTTSLAESRRLIALAQESGLALM
ENVMFIHHSQHDAVRKLVWDGVIGELRAFHAAFAIPRLPDDDIRYVPELGGGALWDTGVY
PVRAALHFLGDNLQVLGAMLTQEPGRRVDTAGSALLRTPEGVGVQLTFGLDHGYRSAYEI
WGSQGRITVERAFTPPADHRPLIRVERRGVEEISLSPDDQVAATLRAFTAAVRDGAARDS
VCVRQAELLHELRERALPSRP
selected fasta
>putative NDP-hexose C-3 ketoreductase [oxidoreductase homolog]
ATGAAGACCGTGCGGATCGGAGTCCTCGGCTGCGCGGACATCGCACGCCGCCGCATGCTG
CCCGCCATGGCGGCGGAGCCCGGCATCACCATCGCCGCCGTCGCCAGCCGCGACAGCGCG
AGGGCGGGCGAGCTGGCAGGGCGGTTCGGCGCCCGGCCCGTGACCGGGTACGCCGAGCTC
CTGGAGCGGGACGACATCGACGCGGTGTACGTCCCGCTGCCCGCCGCCCTGCACGCGCGG
TGGACCGAGGCGGCCCTGCGGCGGGGCAAGCACGTCCTCGCCGAGAAGCCGCTCACCACG
TCCCTGGCCGAGAGTCGCCGGCTGATTGCCCTGGCACAGGAGTCGGGTCTCGCCCTGATG
GAGAACGTCATGTTCATCCATCACTCCCAGCACGACGCCGTACGGAAACTCGTGTGGGAC
GGCGTGATCGGCGAGCTGCGCGCCTTCCACGCAGCGTTCGCGATCCCCAGGCTGCCCGAC
GACGACATCCGGTACGTCCCGGAGCTCGGCGGCGGGGCACTGTGGGACACCGGCGTCTAT
CCGGTGCGTGCCGCCCTGCACTTTCTGGGCGACAACCTCCAGGTGCTCGGCGCCATGCTC
ACCCAGGAACCCGGCCGGCGGGTGGACACCGCGGGCTCGGCGCTGCTGCGCACGCCCGAA
GGCGTCGGCGTCCAGCTGACGTTCGGGCTCGACCACGGCTACCGATCGGCCTACGAGATC
TGGGGCAGCCAGGGGCGGATCACGGTGGAGCGGGCCTTCACACCACCCGCCGACCACCGT
CCCCTGATCCGGGTCGAGCGCCGCGGTGTCGAGGAGATCTCGCTGAGCCCCGACGACCAG
GTGGCCGCCACCCTCCGGGCGTTCACCGCGGCGGTACGCGACGGTGCGGCGCGGGATTCG
GTGTGCGTGCGCCAGGCGGAGCTGCTGCACGAGCTGCGCGAGCGCGCGCTGCCGAGCCGA
CCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [4-121]  3.39999999999999e-28 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [135-240]  1.9e-08 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [1-145]  6.09999999999996e-45 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-24]  0.312 Signal
Bacteria, Gram-positive   
 [1-24]  0.268 Signal
Bacteria, Gram-negative   
TMHMM No significant hit