close all open/close all

CDS information : Lando_00180


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction18,740 / 19,387 / + [in whole cluster]
18,740 / 19,387 / + [in contig]
Location18740..19387 [in whole cluster]
18740..19387 [in contig]
TypeCDS
Length648 bp (215 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)LanU
Gene
Gene (GenBank)lanU
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)

close this sectionSequence

selected fasta
>hypothetical protein [LanU]
MDSPSVPATGGPPRVCPWEQATISDPGRAAFAANPRTGAGHVVVAHSDGGEPALVAAAEP
GGDAFVGFDVSRHGHRFAVGLPRLPGVHGHGERRRHWRRCGSTSPARASRAGSWWRRFPG
RKRRRGRCGLTCIPASRTCAYSRPLHLRRAGAVVAARRRGHGGPDEPAVGGAPILPPQPP
AFLEECLLTRDAAVQASGARPGAPVTELACQSAVR
selected fasta
>hypothetical protein [LanU]
GTGGACTCCCCGTCGGTCCCGGCTACGGGCGGTCCGCCGCGAGTCTGCCCCTGGGAGCAG
GCCACGATCTCGGACCCGGGGCGGGCCGCCTTCGCCGCGAACCCCCGGACCGGCGCCGGC
CACGTCGTGGTCGCCCACTCCGACGGCGGCGAGCCGGCCCTGGTGGCGGCTGCCGAGCCG
GGCGGCGACGCCTTCGTCGGCTTCGACGTCTCGCGGCACGGCCATCGCTTCGCCGTAGGG
CTGCCCCGGCTGCCGGGCGTGCACGGCCACGGCGAACGGCGGCGCCACTGGAGGCGCTGC
GGTTCCACCAGCCCGGCGCGTGCCAGCAGGGCAGGGAGCTGGTGGCGCCGGTTTCCGGGC
AGGAAGCGTCGGAGGGGCCGTTGTGGCCTGACATGTATCCCGGCATCGCGCACGTGTGCG
TACTCCCGTCCACTTCACCTTCGCCGGGCAGGAGCAGTGGTGGCGGCACGCCGACGAGGC
CACGGCGGACCTGACGAGCCGGCTGTGGGCGGCGCCCCGATCCTGCCACCGCAGCCGCCG
GCGTTCCTCGAAGAGTGCCTGCTGACGCGCGACGCCGCCGTCCAGGCTTCCGGTGCGCGC
CCCGGGGCCCCCGTCACGGAACTCGCATGTCAGAGTGCGGTTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit