close all open/close all

CDS information : Lando_00190


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction19,517 / 20,278 / + [in whole cluster]
19,517 / 20,278 / + [in contig]
Location19517..20278 [in whole cluster]
19517..20278 [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductC-6 ketoreductase
Product (GenBank)reductase homolog
Gene
Gene (GenBank)lanV
EC number
Keyword
  • R-stereochemistry
Note
Note (GenBank)
  • LanV
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
[16283688] LanV, a bifunctional enzyme: aromatase and ketoreductase during landomycin A biosynthesis. (Chembiochem. , 2005)
[22633416] Tailoring enzymes involved in the biosynthesis of angucyclines contain latent context-dependent catalytic activities. (Chem Biol. , 2012)
[22454092] Elucidation of post-PKS tailoring steps involved in landomycin biosynthesis. (Org Biomol Chem. , 2012)
[23848284] Structural and Functional Analysis of Angucycline C-6 Ketoreductase LanV Involved in Landomycin Biosynthesis. (Biochemistry. , 2013)
[25200607] Structure-based engineering of angucyclinone 6-ketoreductases. (Chem Biol. , 2014)

close this sectionSequence

selected fasta
>C-6 ketoreductase [reductase homolog]
MGNLTGKTALVTGASRGIGRAIAEKLGYAGALVAVHYATGADAAAEVAESIEKDGGRAFT
VKAELGVPGDVDVLFEGLERGLKERTGATDLDILVNNAGVMAMGAPEEVTPEMFDRMMAV
NAKAPFFIVQRALSVMPDGGRIINVSSGLTRVASPDQVTYGMSKGALEQIALHFSRHLGS
RRITVNSVAPGSTDNGSALFQIPEVRETLSQLSTFGEVAEPAAIADVVAFLASEDARWIT
GAFIDASGGTLLG
selected fasta
>C-6 ketoreductase [reductase homolog]
ATGGGCAATCTCACCGGAAAAACGGCACTGGTCACGGGGGCGAGCCGGGGAATCGGCCGG
GCCATCGCCGAAAAGCTCGGATACGCGGGCGCCCTCGTCGCCGTGCACTATGCGACCGGG
GCCGACGCCGCTGCGGAGGTCGCCGAATCCATCGAGAAGGACGGCGGCCGCGCCTTTACC
GTGAAGGCGGAACTCGGCGTCCCCGGCGATGTCGACGTGCTTTTCGAAGGCCTTGAGCGC
GGCCTGAAGGAGCGCACCGGCGCGACCGATCTGGACATCCTGGTGAACAACGCCGGCGTC
ATGGCCATGGGAGCACCCGAAGAGGTCACGCCCGAGATGTTCGACCGCATGATGGCGGTC
AACGCCAAGGCGCCCTTCTTCATCGTGCAGCGCGCCCTGTCCGTCATGCCCGACGGCGGC
CGCATCATCAACGTCTCGTCCGGCCTCACCCGGGTCGCGAGCCCGGACCAGGTGACGTAC
GGAATGAGTAAGGGCGCCCTTGAACAGATAGCGCTGCATTTCTCCCGCCATCTGGGGAGC
CGGCGGATCACCGTCAACAGCGTGGCGCCCGGCAGCACGGACAACGGCAGCGCACTGTTC
CAGATCCCCGAGGTCCGCGAGACGCTGTCGCAGCTCAGCACCTTCGGTGAGGTCGCGGAA
CCGGCGGCCATCGCCGATGTGGTGGCCTTCCTGGCGTCCGAGGACGCCCGCTGGATCACC
GGGGCCTTCATCGACGCCAGCGGCGGCACACTGCTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [89-100]  1.9000006847787e-06 PR00080 [140-148]  1.9000006847787e-06 PR00080 [160-179]  1.9000006847787e-06 PR00080
PR00080   SDRFAMILY
 [7-176]  4.29999999999998e-28 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  1.50000306971104e-29 PR00081 [89-100]  1.50000306971104e-29 PR00081 [134-150]  1.50000306971104e-29 PR00081 [160-179]  1.50000306971104e-29 PR00081 [181-198]  1.50000306971104e-29 PR00081 [214-234]  1.50000306971104e-29 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [4-251]  1.69999999999998e-68 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [147-175]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-43]  0.162 Signal
Bacteria, Gram-negative   
 [1-43]  0.102 Signal
Eukaryota   
 [1-23]  0.283 Signal
Bacteria, Gram-positive   
TMHMM No significant hit