close all open/close all

CDS information : Lando_00200


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction20,687 / 21,808 / + [in whole cluster]
20,687 / 21,808 / + [in contig]
Location20687..21808 [in whole cluster]
20687..21808 [in contig]
TypeCDS
Length1,122 bp (373 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-olivose glycosyltransferase
Product (GenBank)glycosyl transferase homolog
Gene
Gene (GenBank)lanGT2
EC number
Keyword
  • 1st D-olivose
Note
Note (GenBank)
  • LanGT2
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
[15977274] LanGT2 Catalyzes the First Glycosylation Step during landomycin A biosynthesis. (Chembiochem. , 2005)
[21513888] Rational design of an aryl-C-glycoside catalyst from a natural product O-glycosyltransferase. (Chem Biol. , 2011)
[25581707] Structural characterization of O- and C-glycosylating variants of the landomycin glycosyltransferase LanGT2. (Angew Chem Int Ed Engl. , 2015)

close this sectionSequence

selected fasta
>D-olivose glycosyltransferase [glycosyl transferase homolog]
MKILFVASGSPATVFALAPLATAARNAGHDVFMGAVEDMVPYIASAGIPALSIAPSSIRR
YATMDREGNPVRMPETPEEELDFAGHWFGRMAAGSMDALREVTANWRPDLVVGGSMSFAA
ALIAAELGVPYVRQAWDTGDAWRTDPAASDELRPELRALGLDRLPDPALFVDICPPSLRP
ATAPPAQMMRWVPANGQRRLEPWMYTKGNRPRILVTSGSRLVFAKKTGFLRGLVADMAAL
DAEVVIATLDEVAEELRTELPGVRAGWVPLDVVVPTCDVVVHHAGGVTALTAMNAGVPQL
IVSQGGNFVEAGLRISDFGAAITVDENTPEAVEKACGELIGNPSYAERARELSAEIAALP
LPAEVVGALEGLV
selected fasta
>D-olivose glycosyltransferase [glycosyl transferase homolog]
GTGAAAATCCTCTTCGTCGCGAGCGGGAGTCCCGCGACGGTGTTCGCCCTCGCACCGCTC
GCCACCGCAGCGCGCAATGCGGGACACGACGTGTTCATGGGCGCCGTGGAGGACATGGTT
CCTTACATCGCGTCGGCGGGAATTCCGGCGCTCTCCATCGCGCCGTCCTCGATCCGGCGA
TACGCCACCATGGACCGGGAGGGCAATCCGGTCAGGATGCCCGAGACCCCGGAGGAGGAG
CTGGACTTCGCCGGGCACTGGTTCGGGCGGATGGCGGCAGGCAGCATGGACGCGCTGCGG
GAGGTCACCGCGAACTGGCGCCCCGACCTGGTGGTCGGCGGCTCGATGTCCTTCGCAGCC
GCGCTGATCGCCGCCGAACTCGGCGTTCCCTACGTACGACAGGCCTGGGACACCGGCGAC
GCCTGGCGCACGGACCCCGCCGCGAGCGATGAACTTCGCCCGGAGCTACGGGCACTGGGG
CTCGACCGGCTGCCTGATCCGGCCCTCTTCGTCGACATCTGCCCGCCGAGCCTGCGGCCG
GCGACGGCGCCGCCCGCCCAGATGATGCGCTGGGTCCCGGCCAACGGGCAGCGGCGGCTC
GAACCGTGGATGTATACCAAGGGCAACCGGCCGCGCATCCTCGTCACCTCGGGCAGCCGT
TTGGTGTTCGCGAAGAAGACCGGGTTCCTGCGAGGACTGGTCGCCGACATGGCCGCGCTC
GACGCGGAAGTGGTCATCGCGACGCTGGACGAGGTCGCGGAGGAGCTGAGGACCGAACTG
CCCGGCGTACGGGCCGGCTGGGTGCCGCTCGACGTGGTGGTGCCGACCTGCGACGTGGTC
GTACACCACGCGGGCGGCGTCACCGCCCTGACGGCGATGAATGCCGGTGTGCCGCAGCTG
ATCGTGTCGCAGGGCGGCAACTTCGTTGAGGCGGGGCTGCGCATCTCCGACTTCGGAGCA
GCCATCACCGTCGACGAGAACACCCCGGAGGCCGTCGAGAAGGCCTGCGGGGAGCTGATC
GGCAACCCCTCCTATGCCGAGCGGGCGCGGGAGCTCTCCGCGGAGATCGCGGCGCTGCCG
CTGCCCGCCGAAGTGGTGGGAGCGCTGGAGGGTCTGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-134]  8.60000000000001e-12 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [171-261]  1.3e-24 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.998 Signal
Bacteria, Gram-negative   
 [1-27]  0.996 Signal
Bacteria, Gram-positive   
 [1-23]  0.989 Signal
Eukaryota   
TMHMM No significant hit