close all open/close all

CDS information : Lando_00210


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction21,879 / 22,322 / + [in whole cluster]
21,879 / 22,322 / + [in contig]
Location21879..22322 [in whole cluster]
21879..22322 [in contig]
TypeCDS
Length444 bp (147 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative isobutyryl-CoA mutase small subunit
Product (GenBank)LanX
Gene
Gene (GenBank)lanX
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q9RJ84
PmId
[10531377] Cloning and sequencing of the coenzyme B(12)-binding domain of isobutyryl-CoA mutase from Streptomyces cinnamonensis, reconstitution of mutase activity, and characterization of the recombinant enzyme produced in Escherichia coli. (J Biol Chem. , 1999)

close this sectionSequence

selected fasta
>putative isobutyryl-CoA mutase small subunit [LanX]
MRTRNGEHGMSESRPIRVVMAKPEAGGKGSAAPPVLVDAFTKAGIEVVHAGDDQSPAGLV
ATVVREGAQIICISSLLGEHEALFGGVLDLLSEQGVGQVTVIGGGIIPTADIAVLKERGV
TEIFSSGTPPWAAAEWVRDHVRDSSGV
selected fasta
>putative isobutyryl-CoA mutase small subunit [LanX]
ATGAGAACGAGAAATGGAGAGCACGGCATGAGTGAGTCACGTCCGATCCGCGTGGTGATG
GCCAAGCCCGAGGCGGGAGGCAAGGGGTCGGCCGCACCGCCGGTCCTCGTCGACGCCTTC
ACCAAGGCAGGCATCGAGGTCGTCCACGCCGGCGACGACCAGAGCCCGGCGGGCCTGGTC
GCCACTGTCGTCCGTGAGGGCGCCCAGATCATCTGCATCTCAAGCCTGCTGGGCGAGCAC
GAGGCGCTCTTCGGTGGAGTCCTCGACCTCCTCTCCGAGCAGGGCGTCGGGCAGGTGACC
GTGATCGGCGGCGGCATCATCCCGACGGCCGACATAGCGGTGCTCAAGGAACGCGGCGTC
ACGGAGATCTTCTCCTCCGGCACGCCGCCGTGGGCCGCGGCGGAGTGGGTGCGCGACCAC
GTCCGTGATTCGTCCGGCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006158 Cobalamin (vitamin B12)-binding (Domain)
 [11-143]  1.8e-29 G3DSA:3.40.50.280
G3DSA:3.40.50.280   B12_bd
 [35-132]  4e-08 PF02310
PF02310   B12-binding
 [11-147]  1.70000295590053e-33 SSF52242
SSF52242   Cbl-bd
 [15-144]  PS51332
PS51332   B12_BINDING
IPR006159 Methylmalonyl-CoA mutase, C-terminal (Domain)
 [15-143]  1.9e-22 TIGR00640
TIGR00640   Acid_CoA_mut_C
SignalP
 [1-31]  0.183 Signal
Bacteria, Gram-positive   
 [1-31]  0.061 Signal
Eukaryota   
 [1-21]  0.126 Signal
Bacteria, Gram-negative   
TMHMM No significant hit