close all open/close all

CDS information : Lando_00220


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction22,417 / 23,589 / + [in whole cluster]
22,417 / 23,589 / + [in contig]
Location22417..23589 [in whole cluster]
22417..23589 [in contig]
TypeCDS
Length1,173 bp (390 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-olivose glycosyltransferase
Product (GenBank)glycosyl transferase homolog
Gene
Gene (GenBank)lanGT1
EC number
Keyword
  • 2nd D-olivose
  • 5th D-olivose
Note
Note (GenBank)
  • LanGT1
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
[11755402] Elucidation of the function of two glycosyltransferase genes (lanGT1 and lanGT4) involved in landomycin biosynthesis and generation of new oligosaccharide antibiotics. (Chem Biol. , 2001)
[16039521] Iteratively acting glycosyltransferases involved in the hexasaccharide biosynthesis of landomycin A. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>D-olivose glycosyltransferase [glycosyl transferase homolog]
MRVLMINTPVSTHLTPLVPLAWALRAAGHEVLVLGREDVLGAAASAGLNAVSIGDWLKLD
DILVERLGGKRPLQSWGRPALDQLSNVGSLWMPQTLEVLPAYLDLARDFGPDLVLSDPIE
FISLIVGEDLGVPVVQQRWGVDPISDQVRGAGETWFKDILAERGLTGLPRPAVLLDPCPP
SLQLAGVTPGTPMRYVPFNGNGRLPEWLRRDARERGTARRVAVSLGGRTLAYNGVPLMRN
ILDALGSLPDVEVLATVEEEYREALGEVPGNVRVIDPVPLHLLLGSCHAVVHHGGSGTAM
TASAFGLPQLVLPQLADQFWHGDALARVGAAITIESVERQDEPEPVREAAAALLGDPAYE
KAAGELRAEIAAMPAPSRVVTDLEKLVAAR
selected fasta
>D-olivose glycosyltransferase [glycosyl transferase homolog]
ATGCGCGTCCTCATGATCAACACACCCGTTTCGACTCATCTCACCCCGCTGGTCCCGCTC
GCGTGGGCGCTGCGCGCGGCAGGGCACGAGGTGCTGGTGCTCGGCCGCGAGGACGTCCTC
GGCGCGGCCGCGTCAGCGGGCCTGAACGCCGTGAGCATCGGCGACTGGCTCAAGCTGGAC
GACATACTGGTCGAGCGGCTCGGCGGCAAGCGGCCTTTGCAGTCCTGGGGCAGGCCGGCC
CTGGACCAGCTCTCCAACGTCGGCTCCCTGTGGATGCCCCAGACGCTGGAGGTACTGCCC
GCGTACCTGGACCTGGCCCGCGACTTCGGACCCGACCTGGTTCTCTCCGACCCGATCGAG
TTCATCTCGCTGATCGTGGGGGAGGATCTCGGCGTCCCCGTGGTGCAGCAGCGCTGGGGT
GTCGACCCCATCTCGGACCAGGTCCGCGGCGCGGGCGAGACCTGGTTCAAGGACATCCTC
GCGGAGCGGGGCCTGACCGGCCTGCCGCGCCCGGCCGTCCTGCTCGACCCGTGCCCGCCC
AGCCTCCAGCTGGCCGGCGTGACTCCCGGCACCCCGATGCGCTATGTGCCCTTCAACGGC
AACGGCCGACTGCCCGAGTGGCTCCGGCGTGATGCCCGGGAGCGCGGAACGGCCCGGCGC
GTCGCCGTCTCTCTGGGAGGGCGCACTCTCGCGTACAACGGTGTCCCCCTCATGCGGAAC
ATCCTGGACGCGCTCGGCTCGCTGCCGGACGTCGAAGTGCTGGCGACCGTGGAGGAGGAG
TACCGCGAGGCGCTCGGTGAGGTCCCCGGCAACGTACGCGTCATCGATCCCGTCCCGCTA
CACCTGCTGCTCGGCTCCTGCCACGCCGTCGTCCACCACGGCGGCTCGGGCACGGCCATG
ACCGCGAGCGCCTTCGGCCTGCCGCAGCTCGTCCTGCCCCAGCTGGCGGACCAGTTCTGG
CACGGCGACGCTCTGGCTCGGGTGGGCGCGGCCATCACCATCGAGAGTGTCGAGCGGCAG
GACGAGCCGGAGCCGGTGCGCGAGGCAGCGGCCGCGCTGCTCGGCGACCCGGCCTACGAG
AAGGCGGCGGGGGAACTGCGCGCGGAAATCGCCGCGATGCCGGCCCCGTCTCGGGTCGTG
ACCGACCTGGAGAAGCTGGTCGCGGCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [12-137]  5.5e-08 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [175-273]  8.00000000000001e-27 PF06722
PF06722   DUF1205
SignalP
 [1-26]  0.438 Signal
Bacteria, Gram-positive   
 [1-28]  0.842 Signal
Eukaryota   
TMHMM No significant hit