close all open/close all

CDS information : Lando_00230


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction24,225 / 23,647 / - [in whole cluster]
24,225 / 23,647 / - [in contig]
Locationcomplement(23647..24225) [in whole cluster]
complement(23647..24225) [in contig]
TypeCDS
Length579 bp (192 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductTetR family transcriptional repressor
Product (GenBank)LanK
Gene
Gene (GenBank)lanK
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
[18537830] Coordination of export and glycosylation of landomycins in Streptomyces cyanogenus S136. (FEMS Microbiol Lett. , 2008)
[20583594] Properties of lanK-based regulatory circuit involved in landomycin biosynthesis in Streptomyces cyanogenus S136. (Genetika. , 2010)

close this sectionSequence

selected fasta
>TetR family transcriptional repressor [LanK]
MGGTPHVRGANTRDKIQSVALELFIERGYEKTSMREIAEGLGITKAALYYHFKAKEEILV
AISQGLGGPVDELVAWARTQPRTLETKREVLRRYSEALHGRRSALRIMQESGAALRTLGI
GQTLNDRIAAIGELMYQDGASVRSQVRISDALASVHFGAFFLSAIEGDPEEKRKALLESA
LETLDSSAEEDL
selected fasta
>TetR family transcriptional repressor [LanK]
ATGGGCGGCACACCGCACGTGCGCGGGGCCAACACCCGCGACAAGATCCAGTCCGTCGCC
CTCGAGCTCTTCATCGAGCGCGGCTACGAGAAGACATCGATGCGCGAGATCGCCGAAGGG
CTCGGCATCACCAAGGCGGCGCTCTACTACCACTTCAAGGCCAAGGAAGAGATCCTCGTG
GCGATCTCCCAGGGCCTCGGCGGACCCGTCGACGAGCTGGTCGCCTGGGCACGGACGCAG
CCACGGACCCTGGAGACCAAGCGGGAAGTGCTGCGCCGCTACAGCGAGGCGCTGCATGGG
CGCCGCTCCGCTCTCCGCATCATGCAGGAGAGCGGGGCGGCACTCCGTACCCTCGGGATC
GGCCAGACCCTCAACGACCGGATCGCCGCCATCGGTGAGCTGATGTACCAGGACGGCGCG
TCCGTCCGCAGCCAGGTCCGCATCTCCGACGCCCTGGCCAGCGTGCACTTCGGCGCCTTC
TTCCTGTCGGCGATCGAGGGCGACCCGGAGGAGAAGCGGAAGGCGCTGCTTGAATCCGCG
CTGGAGACCCTGGACTCGTCGGCCGAGGAGGACCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [10-70]  PS50977
PS50977   HTH_TETR_2
 [16-29]  1.20000117458134e-11 PR00455 [37-60]  1.20000117458134e-11 PR00455
PR00455   HTHTETR
 [16-62]  1.2e-19 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [8-86]  1.79999754022375e-17 SSF46689
SSF46689   Homeodomain_like
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [8-186]  1.1e-25 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR023772 DNA-binding HTH domain, TetR-type, conserved site (Conserved_site)
 [28-59]  PS01081
PS01081   HTH_TETR_1
SignalP No significant hit
TMHMM No significant hit