close all open/close all

CDS information : Lando_00240


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction24,415 / 25,968 / + [in whole cluster]
24,415 / 25,968 / + [in contig]
Location24415..25968 [in whole cluster]
24415..25968 [in contig]
TypeCDS
Length1,554 bp (517 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productlandomycins resistance transporter
Product (GenBank)LanJ
Gene
Gene (GenBank)lanJ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
[18537830] Coordination of export and glycosylation of landomycins in Streptomyces cyanogenus S136. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>landomycins resistance transporter [LanJ]
MSHDPTAGRAAVVAPPNRRLFAVMTAAVVAMLLAALDSLILGTAMPTIVGELGGLEHLSW
VASAYMLATAATTPIWGKLGDMYGRKGVFLTSIALFLAGSVVAGLAQSMGQLIGCRVLQG
LGSGGLMVGALSLIGELVTPRERGKFQAMSSAVMGVAMVGGPLAGGFLTDHLGWRYCFYV
NVPFGLAAFVTIAVALKLPKRRSQAPIDYLGAALLAAVITSLVLVTTWGGRQYDWSSPVI
IGLIAIAVAGAFTLPAVERRAVAPVLPLTVFRSANFSWANVVSFLFGFVMVAAMTFLPIY
QQTVQGASASSAGLLMLPLLLGMVGTNAFGGQLMSKQGNFKLYAIAGGVLLLAGILLLSL
MDTKTGRLETGTYMVVFGVGLGLLMQVTLSVAMESVEMKDLGVASSMVTLTRTIGGAFGV
SLAGIIFNERVTAGMGAAGGAMGGDINRLSAESLLKLPEPVREVYEKAVADGTHWAFLTV
SVVAAAALAASWFIKARPKSAAPPLATAPTDQVGAAG
selected fasta
>landomycins resistance transporter [LanJ]
ATGTCGCACGACCCGACCGCGGGAAGGGCGGCCGTCGTGGCACCGCCGAATCGCCGTTTG
TTCGCCGTGATGACGGCGGCCGTGGTGGCGATGCTGCTCGCGGCGCTGGACAGCCTCATC
CTGGGCACCGCCATGCCGACCATCGTCGGCGAGCTGGGCGGCCTCGAACACCTCTCATGG
GTGGCCTCGGCGTACATGCTCGCAACCGCCGCCACGACGCCGATCTGGGGCAAGCTCGGC
GACATGTACGGCCGCAAGGGGGTCTTTCTGACGTCGATCGCCCTCTTCCTCGCGGGCTCC
GTCGTGGCGGGCCTTGCCCAGTCCATGGGCCAGCTCATCGGCTGCCGGGTGCTGCAGGGC
CTCGGCTCCGGAGGCCTGATGGTCGGCGCGCTCTCCCTCATCGGCGAGCTGGTCACTCCG
CGGGAGCGCGGCAAGTTCCAGGCCATGTCGTCGGCCGTCATGGGCGTGGCGATGGTCGGC
GGCCCGCTGGCCGGCGGTTTCCTCACCGATCACCTGGGCTGGCGCTACTGCTTCTACGTC
AACGTGCCGTTCGGCCTCGCCGCCTTCGTGACGATCGCGGTCGCGCTGAAGCTGCCGAAG
CGGCGCTCCCAGGCTCCCATCGACTATCTGGGTGCCGCCCTGCTTGCCGCGGTGATCACC
TCGCTGGTGCTGGTCACCACCTGGGGCGGCAGGCAGTATGACTGGTCGTCGCCGGTGATC
ATCGGCCTGATCGCGATCGCGGTGGCCGGGGCCTTCACCCTGCCGGCCGTGGAACGCCGT
GCCGTCGCGCCGGTGCTGCCGCTGACCGTCTTCCGCAGCGCCAACTTCAGCTGGGCCAAC
GTCGTCTCCTTCCTCTTCGGCTTCGTGATGGTCGCCGCGATGACCTTCCTGCCGATCTAC
CAGCAGACCGTGCAGGGCGCCTCGGCCTCCAGCGCGGGACTGCTGATGCTCCCGCTTCTG
CTCGGCATGGTCGGCACGAACGCGTTCGGTGGCCAACTCATGTCCAAGCAGGGCAACTTC
AAGCTGTACGCGATCGCCGGCGGCGTCCTCCTCCTCGCCGGCATCCTTCTGCTCTCTCTG
ATGGACACCAAGACCGGACGCCTTGAGACCGGCACCTACATGGTGGTCTTCGGGGTCGGC
CTCGGCCTGCTGATGCAGGTGACCCTGTCCGTGGCGATGGAGAGCGTCGAGATGAAGGAC
CTGGGCGTGGCCTCCTCCATGGTCACGCTCACCCGAACGATCGGCGGCGCCTTCGGTGTC
TCGCTCGCCGGCATCATCTTCAACGAGCGGGTCACCGCGGGCATGGGCGCCGCGGGCGGC
GCCATGGGTGGTGACATCAACAGGCTGAGCGCGGAGAGCCTGCTGAAGCTGCCGGAGCCG
GTGCGCGAGGTCTACGAGAAGGCAGTCGCCGACGGCACGCACTGGGCCTTCCTGACCGTC
TCGGTGGTCGCTGCGGCCGCACTCGCCGCCTCGTGGTTCATCAAGGCCAGGCCCAAGTCG
GCGGCTCCGCCGCTCGCGACCGCCCCGACCGACCAGGTCGGCGCCGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [24-432]  2.50000000000001e-71 TIGR00711
TIGR00711   Efflux_EmrB
IPR005829 Sugar transporter, conserved site (Conserved_site)
 [118-143]  PS00217
PS00217   SUGAR_TRANSPORT_2
IPR011701 Major facilitator superfamily (Family)
 [29-419]  1.9e-50 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-499]  8.89993011983204e-74 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [23-499]  PS50850
PS50850   MFS
SignalP
 [1-42]  0.842 Signal
Eukaryota   
TMHMM
 [21-43]  Transmembrane (i-o) [58-80]  Transmembrane (o-i) [87-106]  Transmembrane (i-o) [116-138]  Transmembrane (o-i) [150-169]  Transmembrane (i-o) [174-196]  Transmembrane (o-i) [209-231]  Transmembrane (i-o) [235-257]  Transmembrane (o-i) [277-299]  Transmembrane (i-o) [309-331]  Transmembrane (o-i) [338-360]  Transmembrane (i-o) [370-392]  Transmembrane (o-i) [405-427]  Transmembrane (i-o) [472-494]  Transmembrane (o-i)
Transmembrane 14