close all open/close all

CDS information : Lando_00250


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction26,033 / 26,611 / + [in whole cluster]
26,033 / 26,611 / + [in contig]
Location26033..26611 [in whole cluster]
26033..26611 [in contig]
TypeCDS
Length579 bp (192 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)NDP-hexose 3,5-epimerase homolog
Gene
Gene (GenBank)lanZ1
EC number5.1.3.-
Keyword
  • L-rhodinose
Note
Note (GenBank)
  • LanZ1
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q9S0P2
NITE
Aver_00150
PmId
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [NDP-hexose 3,5-epimerase homolog]
MQAVEAKVPGVHVLAPWTGSKDERGAFFESLRTDLLQDVVGHPFEVKQINYSVSRRNHLR
GIHSVTSPPGQAKYVSCVRGAFRDFVVDLRVGSPTFGQYDVNLLDAASGRALYIPEGVGH
GFLTLTEDACICYVLSSTYVPGTQIDIDPLDPDLALPWGFTEPPLISEKDRTARSLAATL
EAGLLSEWPGGN
selected fasta
>putative NDP-hexose epimerase [NDP-hexose 3,5-epimerase homolog]
GTGCAGGCAGTCGAGGCGAAAGTGCCGGGTGTCCACGTCCTGGCACCGTGGACCGGATCC
AAGGACGAGCGCGGTGCCTTCTTCGAGTCGCTGCGCACCGACCTGCTCCAGGACGTCGTG
GGGCACCCCTTCGAAGTGAAGCAGATCAACTACTCGGTGTCTCGCCGCAACCACCTGCGG
GGGATCCACAGCGTCACCAGCCCGCCGGGGCAGGCCAAGTACGTCTCCTGCGTCCGCGGC
GCGTTCCGTGACTTCGTCGTCGACCTGCGGGTGGGCTCGCCGACCTTCGGGCAGTACGAC
GTCAACCTCCTCGATGCCGCATCGGGCCGCGCCCTCTACATCCCGGAGGGCGTGGGGCAC
GGCTTCCTCACGCTCACCGAGGACGCCTGCATCTGCTACGTCCTGTCGAGCACGTACGTC
CCCGGCACCCAGATCGACATCGACCCCCTCGACCCGGATCTCGCCCTGCCGTGGGGCTTC
ACCGAGCCGCCGCTGATCTCCGAGAAGGACAGGACGGCGCGTTCGCTCGCCGCCACCCTG
GAGGCCGGACTCCTCTCGGAGTGGCCCGGCGGCAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [1-177]  PD001462
PD001462   dTDP_sugar_isom
 [5-177]  2.19999999999997e-46 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-183]  8.20001307135067e-62 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-183]  9.69999999999989e-55 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit