close all open/close all

CDS information : Lando_00260


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction26,719 / 27,924 / + [in whole cluster]
26,719 / 27,924 / + [in contig]
Location26719..27924 [in whole cluster]
26719..27924 [in contig]
TypeCDS
Length1,206 bp (401 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-olivose glycosyltransferase
Product (GenBank)glycosyl transferase homolog
Gene
Gene (GenBank)lanGT3
EC number
Keyword
  • 4th D-olivose
Note
Note (GenBank)
  • LanGT3
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
[15515090] Function of lanGT3, a glycosyltransferase gene involved in landomycin A biosynthesis. (Chembiochem. , 2004)
[17139690] Generation of new landomycins with altered saccharide patterns through over-expression of the glycosyltransferase gene lanGT3 in the biosynthetic gene cluster of landomycin A in Streptomyces cyanogenus S-136. (Chembiochem. , 2007)

close this sectionSequence

selected fasta
>D-olivose glycosyltransferase [glycosyl transferase homolog]
MRVLFVVSPSQAISPTLQRRLAWALRDAGHEVLVAGQPDILATARAAGLHTATVGEPFRM
DEMLLGRLPAGQRLLQSWGRFPDLAQAADFARSWADHNRTVLPGYLDLARAYGPDLLVSD
VLEYSALIVGGVLGVPVVQHRWGVDHMSEPTRVQARETHADLCAALGLPGLPDPETVLDP
CPPTLQLPDVTPGTPIRHAHSHGNGNLPDWLRAEWAAAAADPAADRPRRVIVSLGRSTLA
LNGVPLFRSILRAFVDLPGVEAVVTVDREHRAELGEPPAGVRLADPVPLHMLFRTADAVV
HHGGAGTTMSAGYAGLPQLVLPQFADTFASAGQLVRAGAGIALETAAEQDDPARISAALD
ELLAEPRYTKAAASLGREMADMPAPSRVVEGLDDGWSDTAG
selected fasta
>D-olivose glycosyltransferase [glycosyl transferase homolog]
ATGCGTGTCCTCTTCGTCGTCAGCCCGTCGCAGGCCATCTCTCCCACCCTGCAGCGCAGG
CTGGCCTGGGCGCTCCGAGACGCGGGGCACGAGGTGCTGGTGGCGGGACAGCCCGACATC
CTCGCCACGGCCCGTGCGGCGGGCCTGCACACCGCGACCGTCGGTGAGCCCTTCCGCATG
GACGAGATGCTGCTCGGACGGCTCCCCGCAGGGCAGCGGCTGCTCCAGTCCTGGGGGCGC
TTCCCCGACCTGGCGCAGGCTGCCGACTTCGCTCGTTCCTGGGCGGACCACAACAGGACC
GTGCTGCCCGGCTACCTGGACCTCGCCCGCGCCTACGGCCCGGACCTGCTGGTCAGCGAT
GTACTGGAGTACAGCGCGCTGATCGTGGGCGGCGTTCTCGGGGTCCCCGTGGTGCAGCAC
CGGTGGGGCGTCGACCACATGTCGGAGCCAACCCGGGTCCAGGCCCGCGAGACCCACGCG
GACCTCTGCGCGGCGCTAGGCCTGCCCGGTCTACCCGACCCGGAGACCGTGCTCGACCCG
TGCCCGCCCACCCTCCAACTGCCCGACGTGACACCGGGAACGCCGATCCGGCACGCCCAC
TCGCACGGCAACGGCAACCTGCCGGACTGGCTGCGGGCCGAGTGGGCGGCCGCGGCGGCG
GACCCCGCGGCCGACCGGCCCCGGCGCGTGATCGTCTCCCTGGGCCGCAGCACCCTCGCA
CTCAACGGCGTGCCCCTCTTCCGGAGCATCCTGCGGGCGTTCGTGGATCTGCCCGGAGTC
GAGGCCGTGGTGACGGTGGACCGGGAACACCGGGCGGAACTGGGCGAGCCGCCCGCCGGG
GTACGGTTGGCCGACCCCGTCCCGCTGCACATGCTGTTCCGCACCGCCGACGCGGTCGTC
CACCACGGGGGAGCCGGGACCACGATGAGCGCCGGCTACGCGGGGCTGCCCCAGCTCGTC
CTGCCGCAGTTCGCCGACACGTTCGCGAGCGCCGGACAGCTCGTCCGCGCCGGAGCCGGC
ATCGCCCTGGAGACCGCGGCCGAGCAGGACGATCCCGCGCGGATCAGCGCCGCCCTGGAC
GAACTCCTCGCCGAGCCCCGGTACACGAAGGCCGCGGCGTCGCTCGGCCGGGAGATGGCC
GACATGCCCGCGCCGTCCCGCGTCGTCGAGGGCCTCGACGACGGCTGGTCGGACACTGCG
GGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007235 Glycosyl transferase, family 28, C-terminal (Domain)
 [291-375]  1.1e-05 PF04101
PF04101   Glyco_tran_28_C
IPR010610 Domain of unknown function DUF1205 (Domain)
 [178-282]  1.1e-15 PF06722
PF06722   DUF1205
SignalP
 [1-24]  0.332 Signal
Bacteria, Gram-positive   
TMHMM No significant hit