close all open/close all

CDS information : Lando_00270


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction28,011 / 28,997 / + [in whole cluster]
28,011 / 28,997 / + [in contig]
Location28011..28997 [in whole cluster]
28011..28997 [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative nucleotidyltransferase
Product (GenBank)NDP-hexose synthetase homolog
Gene
Gene (GenBank)lanZ2
EC number
Keyword
Note
Note (GenBank)
  • LanZ2
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
[16039521] Iteratively acting glycosyltransferases involved in the hexasaccharide biosynthesis of landomycin A. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>putative nucleotidyltransferase [NDP-hexose synthetase homolog]
MKALVLSGGTGTRLRPLTHSLPKQLIPLAGRPVVAHVLDSVRDLGVRETGIVVTDGGEQI
EQALGDGSRSGLSLTYFRQDTPRGFGHALSLARDFLGDDDFVVYRGDTLVTESIADRAAA
FAAERPAAGVVVPEAAPDVELVHFFTPAVHEAVAALAADRPGDAVTPAGAAQWLRAHGGD
VRTGTYTGYWRRIASAEDVLAAHRTLLDGLAPAMDGDVDAQSRITGHVVIEPGAKVVRSW
IEGPAVVSAGALVEESHIGPHATIGRDCSVHGTHVDDSLVLEGATVSPVGRLHGSLIGRF
AHVSAAGRDGAPRRSLVVGDHARVEVAE
selected fasta
>putative nucleotidyltransferase [NDP-hexose synthetase homolog]
ATGAAGGCACTGGTGCTGTCGGGTGGCACAGGCACCCGGTTACGGCCCCTCACCCACTCC
CTGCCCAAGCAACTGATCCCGCTGGCGGGCAGGCCGGTCGTGGCCCACGTCCTCGACAGC
GTCCGGGACCTGGGCGTGCGCGAGACCGGCATCGTCGTCACAGACGGTGGTGAGCAGATC
GAGCAGGCGCTCGGCGACGGCTCCCGGTCGGGCCTCTCCCTCACGTACTTCCGGCAGGAC
ACGCCCCGCGGCTTCGGCCACGCCCTCTCGCTCGCGCGCGACTTCCTCGGGGACGACGAC
TTCGTCGTGTACCGCGGCGACACCCTCGTCACCGAAAGCATCGCCGACCGGGCCGCCGCC
TTCGCCGCGGAGCGACCCGCCGCGGGCGTCGTCGTGCCGGAGGCCGCCCCGGACGTCGAG
CTCGTCCACTTCTTCACCCCCGCTGTCCATGAGGCGGTGGCCGCCCTCGCGGCGGACCGC
CCCGGCGACGCGGTGACGCCGGCCGGTGCCGCCCAGTGGCTCCGCGCGCACGGCGGCGAC
GTACGGACGGGAACGTACACGGGGTACTGGCGGCGGATCGCGTCCGCCGAGGACGTGCTG
GCGGCCCACCGCACCCTGCTCGACGGGCTGGCCCCGGCGATGGACGGCGACGTCGACGCG
CAGAGCCGGATCACCGGCCACGTGGTCATCGAGCCCGGCGCCAAGGTCGTACGGTCCTGG
ATCGAGGGCCCCGCGGTCGTCTCCGCGGGCGCGCTGGTGGAGGAGTCCCACATCGGCCCG
CACGCCACGATCGGCAGGGACTGCTCGGTACACGGCACGCACGTCGACGACTCACTCGTC
CTCGAAGGCGCCACGGTGTCGCCCGTCGGCCGTCTCCACGGCTCCCTGATCGGCCGGTTC
GCGCACGTCAGCGCGGCCGGCCGGGACGGAGCGCCGCGCCGGAGCCTCGTCGTGGGCGAC
CACGCCCGGGTCGAGGTGGCGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-127]  1.1e-21 PF00483
PF00483   NTP_transferase
SignalP No significant hit
TMHMM No significant hit