close all open/close all

CDS information : Lando_00280


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction28,994 / 29,974 / + [in whole cluster]
28,994 / 29,974 / + [in contig]
Location28994..29974 [in whole cluster]
28994..29974 [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)NDP-hexose 4-keto reductase homolog
Gene
Gene (GenBank)lanZ3
EC number
Keyword
  • L-rhodinose
Note
Note (GenBank)
  • LanZ3
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-hexose 4-keto reductase homolog]
MTGTGGQRRVMVLGGTGFLGGHLRTAFPVPKAPKWSVSPETSPGPSARTGAPDECFIALD
LLTATPRELRALFADTAPDVVVNAAGAVWKVTPQQMHRANTELTTTVTAALCETSPGPRL
IQLGSVHEYGAGTRDSGLTEGSTEAPVTPYGRSKLAASRSVLDAAAAGALDGVVLRMANI
VGPGVPAGSLLGDIAARLERYAEDPGATDAELLFPPLRAERDFVDVRDVVDAVLAAARAP
RAEVSGRVINIGSGRAVRTGEVVERLLALSGLPVRLVERAADGAAPGAAADCQKLDVSRA
RRLLGWEPRRDLDASLSGLLSSLSLA
selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-hexose 4-keto reductase homolog]
GTGACCGGGACGGGCGGGCAGCGCCGCGTGATGGTGCTCGGCGGCACCGGATTCCTCGGC
GGGCACCTACGGACCGCGTTCCCGGTCCCGAAGGCGCCCAAGTGGTCTGTGTCTCCAGAG
ACGTCACCCGGACCGTCGGCCCGCACCGGTGCGCCGGACGAATGCTTCATCGCGCTCGAC
CTGCTCACCGCGACTCCCCGGGAGCTGCGCGCCCTGTTCGCCGACACCGCCCCGGACGTG
GTGGTAAACGCCGCGGGCGCGGTGTGGAAGGTGACGCCGCAGCAAATGCACCGGGCCAAC
ACCGAGTTGACGACCACCGTGACAGCCGCGCTGTGCGAGACGTCCCCTGGCCCGCGGCTG
ATCCAGCTGGGCAGCGTGCACGAGTACGGCGCGGGCACCCGCGACAGCGGGCTGACCGAG
GGCAGCACGGAGGCCCCCGTCACCCCCTACGGACGCTCGAAACTGGCCGCGTCGCGGAGC
GTCCTCGACGCGGCAGCTGCCGGCGCGCTCGACGGTGTCGTCCTGCGCATGGCCAACATC
GTCGGCCCCGGCGTCCCGGCCGGCAGCCTCCTCGGCGACATCGCGGCCCGCCTGGAGCGG
TACGCCGAGGACCCCGGGGCCACCGATGCCGAGTTGCTCTTCCCCCCGCTGCGCGCGGAG
CGGGACTTCGTCGACGTACGCGATGTCGTCGACGCCGTGCTCGCCGCCGCCCGTGCGCCC
CGTGCCGAGGTCTCGGGCCGCGTCATCAACATCGGCAGCGGACGCGCGGTCCGGACCGGC
GAGGTGGTCGAGCGGCTGCTCGCGCTGAGCGGGCTGCCGGTCCGACTCGTGGAACGGGCG
GCCGACGGGGCCGCCCCGGGCGCCGCCGCGGACTGCCAGAAGCTGGACGTCTCCCGCGCC
CGGCGGCTCCTCGGCTGGGAGCCGCGCCGGGACCTGGACGCCTCGCTGTCGGGGCTGCTG
TCCAGCCTCTCCCTCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [10-252]  3.40000000000004e-38 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [8-225]  5.09999999999998e-25 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-26]  0.664 Signal
Eukaryota   
TMHMM No significant hit