close all open/close all

CDS information : Lando_00290


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction30,061 / 31,314 / + [in whole cluster]
30,061 / 31,314 / + [in contig]
Location30061..31314 [in whole cluster]
30061..31314 [in contig]
TypeCDS
Length1,254 bp (417 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductL-rhodinose glycosyltransferase
Product (GenBank)glycosyl transferase homolog
Gene
Gene (GenBank)lanGT4
EC number
Keyword
  • 3rd L-rhodinose
  • 6th L-rhodinose
Note
Note (GenBank)
  • LanGT4
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
[11755402] Elucidation of the function of two glycosyltransferase genes (lanGT1 and lanGT4) involved in landomycin biosynthesis and generation of new oligosaccharide antibiotics. (Chem Biol. , 2001)
[16039521] Iteratively acting glycosyltransferases involved in the hexasaccharide biosynthesis of landomycin A. (Chem Biol. , 2005)
[19352642] Differences in the substrate specificity of glycosyltransferases involved in landomycins A and E biosynthesis. (Appl Microbiol Biotechnol. , 2009)

close this sectionSequence

selected fasta
>L-rhodinose glycosyltransferase [glycosyl transferase homolog]
MRVLFAVFPAAAHVHPIVPLAWALQNAGHDVRVAIHPDAVGLVTEAGLAAVPLGARHKLA
GVVEFNSNLDLLDSLDDTLSLDTEDDSARWETQWEVMRNVLLVYQPVLPDLVDFVQDWKP
DLVVWDPFCVPAAVAARVGGAAQARFLWGRDNIGWLRAKSLEQLAARGAAPADDPLVPLM
SDMLAPYGLEYEEEFLTGQWTIDPMPQGMRLPLDLPYTGVRRVPYNGTAALPAWVHQRPE
RPRVVLTLGIGGRGRQLFRQSGVSFPEVVEAVAGLDVELVATVGAAEGKPSARHPDNIRL
IEYMPLNHLLPTCSAIIHHGGGGTFAAAVAHQVPQLVTPMPFWGEAATAQYVADNGAGLV
IDSSQFTPDALRKSLTRLLDDRSFRDGAAALYQEMQAAPSPGDLVPVLEELTARHRR
selected fasta
>L-rhodinose glycosyltransferase [glycosyl transferase homolog]
ATGCGTGTCCTCTTCGCAGTCTTTCCCGCCGCCGCCCATGTGCATCCGATCGTTCCGCTC
GCCTGGGCCCTGCAGAACGCGGGTCACGACGTCCGGGTCGCCATCCACCCCGACGCCGTC
GGCCTCGTCACGGAGGCGGGCCTCGCGGCCGTGCCGCTCGGGGCCCGCCACAAGCTCGCC
GGAGTCGTCGAGTTCAACTCCAACCTCGACCTGCTCGACTCGCTCGATGACACCCTCTCG
CTGGACACCGAGGACGACAGCGCCCGCTGGGAGACCCAGTGGGAGGTGATGCGCAACGTC
CTCCTGGTCTACCAACCGGTCCTGCCCGACCTGGTGGACTTCGTCCAGGACTGGAAGCCC
GACCTGGTCGTCTGGGACCCGTTCTGCGTCCCCGCCGCCGTCGCCGCCCGGGTCGGCGGC
GCCGCGCAGGCCCGCTTCCTGTGGGGGCGGGACAACATCGGCTGGCTGCGGGCCAAGTCC
CTGGAGCAGCTCGCGGCCCGCGGCGCGGCGCCGGCCGACGACCCGCTGGTGCCCCTCATG
AGCGACATGCTGGCGCCCTACGGCCTGGAGTACGAGGAGGAGTTCCTCACCGGCCAGTGG
ACCATCGATCCGATGCCGCAGGGCATGCGGCTTCCCCTCGACCTGCCGTACACCGGCGTG
CGGCGCGTGCCCTACAACGGAACCGCCGCACTGCCCGCCTGGGTCCACCAGCGGCCCGAA
CGCCCCCGGGTGGTCCTGACGCTCGGCATCGGCGGCCGCGGGCGGCAGCTCTTCCGGCAG
AGCGGCGTCTCCTTCCCCGAGGTGGTCGAGGCGGTGGCCGGGCTCGACGTGGAGCTGGTC
GCCACGGTCGGCGCCGCGGAGGGGAAGCCGTCGGCACGACACCCGGACAACATCCGGCTG
ATCGAGTACATGCCCCTCAACCACCTGCTGCCGACCTGCTCGGCGATCATCCACCACGGC
GGCGGCGGCACCTTCGCGGCAGCCGTGGCGCACCAGGTGCCGCAGCTCGTCACGCCGATG
CCCTTCTGGGGCGAGGCCGCCACCGCCCAGTACGTCGCGGACAACGGCGCGGGACTGGTC
ATCGACAGCTCCCAGTTCACCCCGGACGCACTGCGCAAGTCCCTCACCCGGCTCCTGGAC
GACCGCTCCTTCCGGGACGGCGCGGCCGCGCTGTACCAGGAGATGCAGGCAGCACCCAGC
CCCGGCGACCTGGTGCCGGTGCTGGAGGAACTGACCGCCCGTCACCGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-125]  4.2e-21 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [202-299]  8.30000000000004e-29 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.377 Signal
Bacteria, Gram-positive   
 [1-23]  0.972 Signal
Eukaryota   
 [1-23]  0.388 Signal
Bacteria, Gram-negative   
TMHMM No significant hit