close all open/close all

CDS information : Lando_00300


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction31,356 / 31,958 / + [in whole cluster]
31,356 / 31,958 / + [in contig]
Location31356..31958 [in whole cluster]
31356..31958 [in contig]
TypeCDS
Length603 bp (200 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductNADPH-dependent FMN reductase
Product (GenBank)reductase homolog
Gene
Gene (GenBank)lanZ4
EC number1.5.1.38
Keyword
  • two-component system
  • C-11 hydroxylate
Note
Note (GenBank)
  • LanZ4
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
[15812784] Generation of novel landomycins M and O through targeted gene disruption. (Chembiochem. , 2005)
[22454092] Elucidation of post-PKS tailoring steps involved in landomycin biosynthesis. (Org Biomol Chem. , 2012)
Related Reference
ACC
Q6T1C6
PmId
[15123249] Generation of new landomycins by combinatorial biosynthetic manipulation of the LndGT4 gene of the landomycin E cluster in S. globisporus. (Chem Biol. , 2004)
ACC
Q07923
PmId
[15184374] Crystal structure and functional characterization of yeast YLR011wp, an enzyme with NAD(P)H-FMN and ferric iron reductase activities. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>NADPH-dependent FMN reductase [reductase homolog]
MSARAVVPASSPHLALLVGSTRSGGAGRTVARWFLARAEEHGFRDVDVIDLAAIELPVVT
GAVTGEGPPPVVADLARRIDAAEAFVVVTPEYNHSFPAPLKNAIDWFRHEWYAKPVSFVS
YGGISGGLRAVEQLRLVFGELHAVPIRDSVSFHRTREQFDEGGAPKDPVGCGTAAKIMLD
QLSWWARSLTEARAKRPYTA
selected fasta
>NADPH-dependent FMN reductase [reductase homolog]
GTGTCAGCAAGGGCCGTCGTGCCGGCATCGTCACCTCACCTCGCGCTCCTCGTGGGCAGC
ACCCGCTCGGGCGGTGCCGGCCGCACCGTGGCGCGGTGGTTCCTCGCCCGTGCCGAGGAA
CACGGCTTCAGGGACGTCGACGTGATCGACCTGGCCGCGATCGAGCTGCCGGTGGTGACG
GGCGCCGTCACCGGGGAAGGACCACCGCCGGTCGTGGCGGACCTGGCCCGGCGTATCGAC
GCCGCGGAGGCCTTCGTGGTGGTGACGCCGGAGTACAACCACAGCTTCCCCGCCCCGCTG
AAGAACGCCATCGACTGGTTCAGACACGAGTGGTATGCCAAGCCGGTCTCCTTCGTCTCC
TACGGCGGTATCTCCGGCGGACTGCGTGCGGTGGAGCAACTCCGCCTCGTCTTCGGCGAG
TTGCACGCCGTGCCGATCCGGGACTCGGTCAGCTTCCACCGCACCCGGGAGCAGTTCGAC
GAGGGCGGCGCGCCGAAGGACCCGGTGGGCTGCGGCACGGCCGCGAAGATCATGCTCGAC
CAGCTCTCCTGGTGGGCGCGGTCGCTGACCGAGGCCCGGGCGAAACGGCCCTACACAGCA
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005025 NADPH-dependent FMN reductase (Domain)
 [13-153]  7.69999999999997e-40 PF03358
PF03358   FMN_red
SignalP
 [1-26]  0.933 Signal
Eukaryota   
TMHMM No significant hit