close all open/close all

CDS information : Lando_00320


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction33,161 / 33,877 / + [in whole cluster]
33,161 / 33,877 / + [in contig]
Location33161..33877 [in whole cluster]
33161..33877 [in contig]
TypeCDS
Length717 bp (238 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative phosphopantetheinyl transferase
Product (GenBank)LanZ6
Gene
Gene (GenBank)lanZ6
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[9933932] Cloning and characterization of a gene cluster from Streptomyces cyanogenus S136 probably involved in landomycin biosynthesis. (FEMS Microbiol Lett. , 1999)
Related Reference
ACC
Q6T709
PmId
[14695521] Identification of a phosphopantetheinyl transferase for erythromycin biosynthesis in Saccharopolyspora erythraea. (Chembiochem. , 2004)
ACC
Q9F0Q6
PmId
[11451672] Cloning and characterization of a phosphopantetheinyl transferase from Streptomyces verticillus ATCC15003, the producer of the hybrid peptide-polyketide antitumor drug bleomycin. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase [LanZ6]
MGRRVRRTEARASWHDREWDGVLGSVLPSAVVWEEEFGDSASVELFPERAVLVRDAVPRR
VNEFGTVRECARRSLVRLGVAPVPILPGTRGEPRWPPGIVGSMTHCEGFRGAAVAWSQEI
ASFGIDAEPHEPLPPGLLTKSRARRSVVGRAIGRRDPTVHWDRLTFSAKEAVYKAWFPLA
RVAWGSMTSPSHCDPLVRHFRARLYAAGLVLHGQSVTTVTGNWTDERGLICTAVVVEA
selected fasta
>putative phosphopantetheinyl transferase [LanZ6]
ATGGGCCGGCGAGTGCGCCGAACCGAGGCGCGTGCCTCCTGGCATGACAGAGAGTGGGAT
GGAGTGCTCGGCAGCGTTCTGCCATCAGCGGTGGTCTGGGAGGAGGAGTTCGGTGACTCC
GCGTCCGTCGAACTGTTCCCGGAGAGGGCGGTGTTGGTGCGCGATGCCGTACCGCGACGC
GTCAACGAGTTCGGGACGGTCCGTGAGTGTGCGAGGCGGTCCCTGGTAAGGCTTGGAGTG
GCGCCCGTACCCATCCTGCCCGGAACGAGGGGGGAGCCCCGATGGCCTCCAGGCATCGTC
GGCAGCATGACGCACTGCGAGGGATTTCGTGGGGCTGCTGTGGCCTGGAGTCAGGAAATC
GCATCCTTCGGAATCGACGCCGAACCGCATGAACCTCTTCCTCCAGGCCTTCTCACGAAG
TCGCGCGCCCGGAGGAGCGTTGTAGGACGCGCAATTGGGAGGCGTGATCCCACCGTGCAC
TGGGACCGTCTGACCTTCAGCGCCAAAGAAGCCGTTTACAAAGCGTGGTTTCCGCTGGCA
CGCGTCGCCTGGGGTTCCATGACATCGCCATCACATTGCGACCCATTGGTACGACACTTC
CGGGCCCGGCTGTACGCGGCCGGCCTTGTTCTCCATGGGCAGTCCGTAACGACTGTTACC
GGCAACTGGACAGATGAACGCGGCTTGATCTGTACGGCAGTTGTGGTCGAGGCCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003542 Enterobactin synthetase-like, component D (Family)
 [58-78]  1.99999636034521e-23 PR01399 [88-106]  1.99999636034521e-23 PR01399 [164-180]  1.99999636034521e-23 PR01399
PR01399   ENTSNTHTASED
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [119-238]  8.09999844976855e-08 SSF56214
SSF56214   4-PPT_transf
 [123-189]  5.60000000000001e-08 PF01648
PF01648   ACPS
SignalP
 [1-33]  0.076 Signal
Eukaryota   
TMHMM No significant hit