close all open/close all
Lando_00320 Lando_00320   last last

CDS information : Lando_00340


close this sectionLocation

Organism
StrainS136
Entry nameLandomycin
Contig
Start / Stop / Direction35,479 / 34,694 / - [in whole cluster]
1 / 786 / + [in contig]
Locationcomplement(34694..35479) [in whole cluster]
1..786 [in contig]
TypeCDS
Length786 bp (261 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)LanI
Gene
Gene (GenBank)lanI
EC number
Keyword
Note
Note (GenBank)
  • positive regulator of landomycin A biosynthesis
Reference
ACC
PmId
[12757959] Production of landomycins in Streptomyces globisporus 1912 and S cyanogenus S136 is regulated by genes encoding putative transcriptional activators. (FEMS Microbiol Lett. , 2003)
[17786405] Function of lanI in regulation of landomycin A biosynthesis in Streptomyces cyanogenus S136 and cross-complementation studies with Streptomyces antibiotic regulatory proteins encoding genes. (Arch Microbiol. , 2008)
[20583594] Properties of lanK-based regulatory circuit involved in landomycin biosynthesis in Streptomyces cyanogenus S136. (Genetika. , 2010)

close this sectionSequence

selected fasta
>transcriptional activator [LanI]
MGQFSTGTIRHGKPKRLHANLPTRRSLHPVVPQRTEQQGQGVLAILAVGSEESGMSELAQ
GLRRHGYRVEGAATGTKALQVHRNADLVLLDLDLPDLDGLEVCRNIRASSQTPVIAVTAR
ESELDRVLVLQAGADDCMTKPYGIRELMARMDAIMRRIQPQWPLEQVIEHWPLRIDVNSR
EVRLDGRLIEVTRKEFDLLHLLASWPDTVIPRQQLTAQVWGDSVPLRGRTIDTHVSSLRS
KLGSSSWIVTVRGVGFRLGNQ
selected fasta
>transcriptional activator [LanI]
GTGGGTCAGTTTTCGACGGGCACGATACGGCACGGGAAGCCAAAACGTCTTCACGCGAAC
TTACCAACGCGGCGGTCCCTCCACCCTGTTGTTCCACAGCGGACAGAGCAACAGGGCCAG
GGAGTTCTGGCGATCCTCGCGGTCGGAAGCGAGGAGAGCGGAATGAGTGAGCTCGCGCAG
GGGCTGCGACGACACGGCTACCGGGTGGAGGGCGCCGCCACCGGGACCAAAGCGCTCCAA
GTCCACCGAAACGCTGACCTCGTCCTGCTCGACCTGGACCTGCCCGACCTGGACGGACTC
GAGGTCTGCCGCAACATCCGGGCCTCCAGTCAGACTCCGGTCATCGCCGTCACGGCGCGG
GAGTCCGAACTCGACCGCGTGCTGGTCCTGCAGGCCGGCGCTGACGACTGCATGACCAAA
CCGTACGGCATCCGTGAGCTGATGGCCCGTATGGACGCCATCATGCGCAGGATCCAGCCG
CAGTGGCCCCTGGAGCAGGTGATCGAACACTGGCCCCTTCGGATCGACGTGAACTCACGG
GAGGTACGCCTCGACGGAAGGTTGATCGAGGTGACCCGTAAGGAATTCGACCTCCTCCAC
CTCCTCGCTTCCTGGCCTGACACGGTCATTCCCCGCCAGCAGCTGACGGCTCAGGTGTGG
GGTGACTCCGTGCCGCTGCGCGGGCGGACCATAGACACGCATGTCAGCAGCCTGCGCAGC
AAGCTCGGCTCCAGTAGCTGGATCGTCACCGTACGCGGCGTCGGATTCCGGCTCGGTAAC
CAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [46-151]  7.20000000000003e-22 PF00072
PF00072   Response_reg
 [44-155]  PS50110
PS50110   RESPONSE_REGULATORY
 [43-151]  6.59999852526375e-30 SM00448
SM00448   REC
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [186-258]  1.10000150671642e-22 SM00862
SM00862   Trans_reg_C
 [187-258]  7.7e-19 PF00486
PF00486   Trans_reg_C
IPR011006 CheY-like superfamily (Domain)
 [30-179]  7.30000590915208e-30 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [165-258]  7.79999999999999e-28 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [159-261]  3.80000697093586e-24 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-19]  0.136 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Lando_00320 Lando_00320   last last