close all open/close all
first first   Lasal2_00020 Lasal2_00020

CDS information : Lasal2_00010


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction1,129 / 317 / - [in whole cluster]
1,129 / 317 / - [in contig]
Locationcomplement(317..1129) [in whole cluster]
complement(317..1129) [in contig]
TypeCDS
Length813 bp (270 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF01

close this sectionSequence

selected fasta
>[hypothetical protein]
MDDYDPFELQDSDFAPVEATASRLALLTLEEAHDLLRVLVTVAQEGGPVSAEADRLAKEI
AARVPSELSIQAGRRRRGRSRMGAVKQAAALELLGVVEEWQETAEHGWVLDVDGVPREGV
LKAAASGLVELAERDERAELSARAGRPVRWAARLTGQGRDLLLYARSQHAAGPAAAGPEY
RLVELMPSQMDVVRVVTGLADQLQVPPAPGLDERVRAAVQDRVSGRWRVYLTAEQMASIA
YGLWLHKMAGSAAEANRFSRDHGIAHTSAT
selected fasta
>[hypothetical protein]
GTGGACGACTACGACCCTTTCGAGCTCCAGGACAGTGACTTCGCGCCCGTTGAGGCGACA
GCGAGCCGGCTCGCGTTGCTGACTCTTGAGGAAGCCCATGATCTGCTGCGGGTGCTGGTG
ACGGTGGCGCAGGAGGGTGGGCCGGTGTCGGCGGAGGCGGACCGGCTGGCGAAGGAGATC
GCCGCGCGCGTCCCGTCGGAACTGAGCATTCAGGCAGGCCGGCGGCGGCGGGGGAGGAGC
AGGATGGGTGCGGTGAAACAGGCGGCGGCGCTCGAGTTGCTGGGCGTAGTGGAGGAGTGG
CAGGAGACCGCGGAGCACGGTTGGGTCCTGGACGTGGACGGGGTGCCGCGCGAGGGCGTG
CTGAAGGCGGCCGCCTCCGGGTTGGTGGAACTGGCCGAGCGCGATGAACGAGCGGAACTC
TCCGCCCGGGCGGGGCGCCCTGTGCGCTGGGCGGCCCGTCTCACCGGTCAGGGCCGTGAC
CTGCTGCTGTACGCCCGGTCTCAGCACGCTGCAGGCCCTGCCGCGGCAGGACCGGAGTAC
CGCCTGGTCGAGCTCATGCCCTCGCAGATGGATGTGGTGCGGGTGGTCACCGGCCTGGCG
GACCAGCTGCAGGTGCCACCCGCGCCGGGCCTGGACGAGCGGGTGCGGGCGGCCGTGCAG
GACCGGGTGAGTGGCCGGTGGCGGGTCTACCTCACCGCGGAGCAGATGGCCTCGATCGCC
TACGGGCTGTGGCTGCACAAGATGGCTGGCTCGGCAGCGGAGGCCAACCGCTTCTCCCGC
GACCACGGCATCGCCCACACCTCGGCAACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit
first first   Lasal2_00020 Lasal2_00020