close all open/close all

CDS information : Lasal2_00020


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction2,379 / 1,471 / - [in whole cluster]
2,379 / 1,471 / - [in contig]
Locationcomplement(1471..2379) [in whole cluster]
complement(1471..2379) [in contig]
TypeCDS
Length909 bp (302 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)Ku70/Ku80 protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF02

close this sectionSequence

selected fasta
>[Ku70/Ku80 protein]
MPRSIWSGAISFGLVTVPVNVVSATESHSIQFHQYHLEDMGRVRVRKFCEVEDREVSTAE
IGKGFQWTKDQVIPISDEELRDLPLPTAKAIEIDAFVPMEDIDPIRIGDGYYLQAGGTVA
AKPYKLLVEALRRSSKVAVAKYAWSGRERLGLLRVHGDALVLHAMHWDDEIRDPSELLPP
PVEVSDEEIEGALALMETMSREDLEGEEFKDTYTEALARIIEAKREHRPLPEAPEPQEPA
KVLDLMSALQESVAKAKASRGEDDGEADVHDMPAPKKKTAKKSASAKKTAAKKTAARRPR
SA
selected fasta
>[Ku70/Ku80 protein]
ATGCCCCGAAGCATCTGGTCCGGCGCCATCTCCTTCGGCCTGGTCACGGTCCCCGTGAAC
GTGGTCAGCGCGACCGAGAGCCACAGCATCCAGTTCCACCAGTACCACCTGGAGGACATG
GGCCGGGTGCGGGTGCGCAAGTTCTGCGAGGTCGAGGACCGCGAGGTGTCCACGGCGGAG
ATCGGCAAGGGTTTTCAGTGGACGAAGGACCAGGTCATTCCCATCTCCGACGAGGAGCTG
CGGGATCTTCCGCTCCCCACAGCGAAGGCCATCGAGATCGATGCGTTCGTCCCGATGGAG
GACATCGATCCGATCCGCATCGGCGACGGCTACTACCTCCAGGCCGGCGGAACGGTCGCG
GCCAAGCCGTACAAGCTGCTCGTTGAGGCGCTGCGCCGCTCCTCGAAGGTGGCGGTGGCG
AAGTACGCGTGGAGCGGGCGGGAGCGCCTGGGCCTGCTGCGGGTGCACGGAGATGCGCTG
GTGCTTCATGCGATGCACTGGGACGACGAGATCCGCGACCCCTCCGAGCTGCTGCCGCCG
CCGGTAGAGGTGAGCGACGAGGAGATCGAGGGTGCGCTCGCGCTGATGGAGACGATGAGC
CGCGAGGACCTGGAGGGCGAGGAGTTCAAGGACACCTACACCGAGGCCCTCGCCCGGATC
ATCGAGGCGAAGCGGGAGCACCGGCCGCTGCCGGAGGCCCCGGAGCCGCAGGAGCCGGCG
AAGGTGCTGGACCTGATGTCCGCGCTGCAGGAGTCGGTGGCCAAGGCGAAGGCCTCCCGC
GGCGAGGACGACGGCGAGGCGGACGTGCACGACATGCCCGCGCCGAAGAAGAAGACCGCG
AAGAAGTCCGCCTCGGCGAAGAAGACCGCCGCGAAGAAGACGGCGGCGCGGCGGCCGCGC
AGCGCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006164 DNA helicase, ATP-dependent, Ku type (Domain)
 [10-183]  1.80000000000002e-33 PF02735
PF02735   Ku
IPR009187 Predicted Ku, prokaryotic type (Family)
 [3-256]  6.10000000000004e-74 TIGR02772
TIGR02772   Ku_bact
 [1-286]  1.79999754022378e-79 PIRSF006493
PIRSF006493   Prok_Ku
IPR016194 Spen Paralogue and Orthologue SPOC, C-terminal-like (Domain)
 [1-261]  1.10000150671643e-52 SSF100939
SSF100939   SPOC-like
 [3-151]  3e-13 G3DSA:2.40.290.10
G3DSA:2.40.290.10   G3DSA:2.40.290.10
SignalP
 [1-24]  0.482 Signal
Bacteria, Gram-positive   
 [1-24]  0.54 Signal
Eukaryota   
TMHMM No significant hit