close all open/close all

CDS information : Lasal2_00030


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction3,312 / 2,632 / - [in whole cluster]
3,312 / 2,632 / - [in contig]
Locationcomplement(2632..3312) [in whole cluster]
complement(2632..3312) [in contig]
TypeCDS
Length681 bp (226 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative secreted protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF03

close this sectionSequence

selected fasta
>[putative secreted protein]
MRFARTFSAAAAFAAALLPATAHAAPASALLRDPGQTVTLPVREALTQIPVASEDRTGYE
RSAFKHWVDADRDGCTTRAEVLKAEAVIAPDQGPRCTLSGGQWYSPYDDRYIQGPSGLDI
DHLVPLAEAWDSGASNWSAAEREAYANDLGDDRALIAVSAASNRSKADQDPTTWMPPAEG
YRCQYATDWIADKLRWRLTADEAESAALTDILSRCSNVPVAVTLAR
selected fasta
>[putative secreted protein]
GTGCGCTTCGCCCGTACCTTCTCGGCTGCCGCCGCCTTCGCGGCCGCACTGCTCCCCGCC
ACCGCCCACGCCGCCCCAGCCTCCGCCCTGCTCCGCGACCCTGGCCAGACCGTGACCCTG
CCCGTGCGCGAGGCACTGACCCAAATTCCGGTGGCCAGCGAGGATCGCACCGGATACGAG
CGCTCGGCGTTCAAGCACTGGGTCGACGCGGACCGGGACGGCTGCACCACCCGCGCCGAA
GTCCTCAAGGCAGAGGCCGTCATCGCCCCCGACCAAGGACCGCGCTGCACCCTGTCAGGA
GGCCAGTGGTACTCGCCCTACGACGACCGCTACATCCAAGGTCCGAGCGGCCTGGACATC
GACCACCTGGTCCCGCTGGCAGAGGCCTGGGACTCTGGCGCCTCGAACTGGTCGGCCGCC
GAACGCGAGGCGTACGCCAACGACCTGGGCGACGATCGCGCACTGATCGCGGTGTCGGCC
GCCTCGAACCGGTCGAAGGCGGACCAGGACCCCACCACGTGGATGCCTCCGGCCGAGGGC
TACCGCTGCCAGTACGCCACCGACTGGATCGCCGACAAACTCCGCTGGCGCCTGACAGCC
GACGAAGCGGAATCGGCTGCCCTGACAGACATCCTCAGCCGCTGCTCTAACGTGCCCGTC
GCCGTCACGCTCGCCCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011089 Domain of unknown function DUF1524 (Domain)
 [97-211]  1.7e-14 PF07510
PF07510   DUF1524
SignalP
 [1-24]  0.934 Signal
Bacteria, Gram-negative   
 [1-24]  0.836 Signal
Bacteria, Gram-positive   
 [1-24]  0.772 Signal
Eukaryota   
TMHMM No significant hit