close all open/close all

CDS information : Lasal2_00040


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction5,002 / 3,605 / - [in whole cluster]
5,002 / 3,605 / - [in contig]
Locationcomplement(3605..5002) [in whole cluster]
complement(3605..5002) [in contig]
TypeCDS
Length1,398 bp (465 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative MFS-type efflux protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF04; 77 permeases of the major facilitator superfamily

close this sectionSequence

selected fasta
>[putative MFS-type efflux protein]
MPLAALCLAFFVEMVDNTLLSIALPTIGRDLGSGTTALQWVTGAYSLTFGGLLLTAGSLA
DRLGRRRVLLVGLAAFGLLSLCVVAVNSAGQLIALRAGLGIAAAAAMAPITNSLVFRLFD
DQALRMRAMTLMIVVGMSGFVLGPLLGGTALAHVRWEWLLVVNAPIALIAAIGVRLGAAA
DQPDDLTKDRLDLPGAVLSVLTIGLACYSLTSGVEHGWFSPTTITSILGAVAAGFAFVWH
ERRSAAPMLDLKLFSSGTVRGAAIAQIGTSIAMAGVMFGLILHFQYAYGWSPVRAGLANL
PIIITMIIATPLSEWLGKRFGHRAACLVGAACLAAALAGLAWGVDHGYAAIAVSMVVMTI
GLRTVMTICAIALVEAMPANRTSIGTALNDTAQEVGTSVGTAVVGTLIAALVTTQLPAGV
WSSDLVHSFFHGERITYAVLAVIVGVIATGGALTLTDSHSVEEPA
selected fasta
>[putative MFS-type efflux protein]
ATGCCCCTGGCCGCCCTCTGCCTCGCCTTCTTCGTCGAGATGGTCGACAACACGCTGCTC
TCCATCGCCCTGCCCACCATCGGCCGCGACCTCGGCAGCGGCACGACCGCCCTGCAATGG
GTCACCGGCGCCTACTCGCTGACCTTCGGCGGCCTCCTCCTCACGGCAGGGTCACTCGCC
GACCGGCTCGGCCGACGCCGCGTCCTGCTCGTCGGCCTCGCCGCCTTCGGACTGCTCAGC
CTCTGCGTCGTCGCGGTCAACTCCGCAGGACAGCTCATAGCGCTGCGCGCCGGGCTCGGC
ATCGCCGCCGCCGCCGCCATGGCACCCATCACCAACTCCCTCGTCTTCCGGCTCTTCGAC
GACCAGGCGCTGCGCATGCGCGCGATGACCCTGATGATCGTCGTCGGCATGTCCGGCTTC
GTCCTCGGCCCGCTGCTCGGCGGCACGGCCCTCGCCCACGTGCGCTGGGAATGGCTGCTC
GTGGTCAACGCCCCGATCGCGCTGATCGCGGCCATCGGCGTGCGCCTCGGGGCAGCCGCC
GACCAACCCGACGACCTGACCAAGGACCGCCTCGACCTGCCGGGCGCCGTCCTGAGCGTC
CTCACCATCGGCCTGGCCTGCTACTCCCTGACCAGCGGCGTCGAGCACGGCTGGTTCTCC
CCGACCACCATCACATCGATCCTCGGCGCCGTCGCCGCCGGCTTCGCGTTCGTGTGGCAC
GAGCGCCGCAGCGCCGCGCCCATGCTCGACCTCAAGCTCTTCTCCAGCGGAACCGTCCGC
GGCGCGGCCATCGCTCAGATTGGCACGTCCATCGCGATGGCCGGCGTGATGTTCGGGCTG
ATCCTCCACTTCCAGTACGCCTACGGCTGGAGCCCCGTGCGGGCGGGCCTGGCGAACCTG
CCGATCATCATCACCATGATCATCGCGACGCCGCTGTCGGAATGGCTCGGCAAGCGCTTC
GGGCACCGGGCCGCCTGCCTGGTCGGCGCGGCCTGTCTGGCCGCCGCTCTGGCCGGCCTC
GCCTGGGGCGTCGACCACGGGTACGCCGCTATCGCCGTCTCCATGGTCGTGATGACGATC
GGGCTGCGCACCGTGATGACGATCTGTGCCATCGCCCTGGTCGAAGCGATGCCGGCCAAC
CGCACGTCGATCGGCACCGCCCTCAACGACACCGCCCAGGAGGTCGGGACCAGCGTCGGC
ACGGCCGTCGTCGGCACCCTGATCGCCGCACTGGTCACCACCCAACTGCCCGCGGGCGTG
TGGAGCAGCGACCTCGTGCACTCCTTCTTCCACGGCGAGCGGATCACGTACGCCGTACTC
GCAGTGATCGTCGGGGTGATCGCGACGGGCGGTGCGCTCACGCTCACCGACTCCCACTCA
GTGGAGGAGCCAGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [6-400]  2.1e-42 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-454]  2.1000026783403e-56 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [2-459]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [5-27]  Transmembrane (i-o) [37-59]  Transmembrane (o-i) [68-90]  Transmembrane (i-o) [94-116]  Transmembrane (o-i) [129-151]  Transmembrane (i-o) [156-178]  Transmembrane (o-i) [191-213]  Transmembrane (i-o) [217-239]  Transmembrane (o-i) [259-281]  Transmembrane (i-o) [291-313]  Transmembrane (o-i) [320-342]  Transmembrane (i-o) [352-374]  Transmembrane (o-i) [395-414]  Transmembrane (i-o) [434-456]  Transmembrane (o-i)
Transmembrane 14