close all open/close all

CDS information : Lasal2_00050


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction5,479 / 6,051 / + [in whole cluster]
5,479 / 6,051 / + [in contig]
Location5479..6051 [in whole cluster]
5479..6051 [in contig]
TypeCDS
Length573 bp (190 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF05; dihydroxy-acid dehydratase, phage-like element

close this sectionSequence

selected fasta
>
MAIRINKRVPRLVSVLPNGPVYHPTVNAFMAGGVPEVMLHLRSLGLLHEDVMTVTGSTLK
ENLDWWEHSERRQRFKQLLLDQEQINADEVIMSPQQAKARGLTSTITFPVGNIAPEGSVI
KSTAIDPSMIDEQGIYYHKGVAKVYLSEKSAIYDIKHDKIKAGDILVIIGVGPSGTGMEE
TYQVTSALKH
selected fasta
>
ATGGCGATCCGCATCAACAAGCGCGTGCCCCGACTGGTGAGCGTACTGCCTAATGGCCCG
GTTTATCATCCAACGGTCAATGCCTTTATGGCAGGTGGTGTGCCGGAAGTCATGTTGCAT
CTGCGCAGCCTCGGATTGTTGCATGAAGACGTTATGACGGTTACCGGCAGCACGCTGAAA
GAAAACCTCGACTGGTGGGAGCACTCCGAACGGCGTCAGCGGTTCAAGCAACTCCTGCTC
GATCAGGAACAAATCAACGCTGACGAAGTGATCATGTCTCCGCAGCAAGCAAAAGCGCGC
GGATTAACCTCAACTATCACCTTCCCGGTGGGCAATATTGCGCCAGAAGGTTCGGTGATC
AAATCCACCGCCATTGACCCCTCGATGATTGATGAGCAAGGTATCTATTACCATAAAGGT
GTGGCGAAGGTTTATCTGTCCGAGAAAAGTGCGATTTACGATATCAAACATGACAAGATC
AAGGCGGGCGATATTCTGGTCATTATTGGCGTTGGACCTTCAGGTACAGGGATGGAAGAA
ACCTACCAGGTTACCAGTGCCCTGAAGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000581 Dihydroxy-acid/6-phosphogluconate dehydratase (Family)
 [4-189]  1.7e-41 PF00920
PF00920   ILVD_EDD
IPR015928 Aconitase/3-isopropylmalate dehydratase, swivel (Domain)
 [105-189]  3.8e-14 SSF52016
SSF52016   LeuD/IlvD-like
SignalP No significant hit
TMHMM No significant hit