close all open/close all

CDS information : Lasal2_00060


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction7,269 / 6,061 / - [in whole cluster]
7,269 / 6,061 / - [in contig]
Locationcomplement(6061..7269) [in whole cluster]
complement(6061..7269) [in contig]
TypeCDS
Length1,209 bp (402 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)IS10 transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF06

close this sectionSequence

selected fasta
>[IS10 transposase]
MCELDILHDSLYQFCPELHLKRLNSLTLACHALLDCKTLTLTELGRNLPTKARTKHNIKR
IDRLLGNRHLHKERLAVYRWHASFICSGNTMPIVLVDWSDIREQKRLMVLRASVALHGRS
VTLYEKAFPLSEQCSKKAHDQFLADLASILPSNTTPLIVSDAGFKVPWYKSVEKLGWYWL
SRVRGKVQYADLGAENWKPISNLHDMSSSHSKTLGYKRLTKSNPISCQILLYKSRSKGRK
NQRSTRTHCHHPSPKIYSASAKEPWILATNLPVEIRTPKQLVNIYSKRMQIEETFRDLKS
PAYGLGLRHSRTSSSERFDIMLLIALMLQLTCWLAGVHAQKQGWDKHFQANTVRNRNVLS
TVRLGMEVLRHSGYTITREDLLVAATLLAQNLFTHGYALGKL
selected fasta
>[IS10 transposase]
ATGTGCGAACTCGATATTTTACACGACTCTCTTTACCAATTCTGCCCCGAATTACACTTA
AAACGACTCAACAGCTTAACGTTGGCTTGCCACGCCTTACTTGACTGTAAAACTCTCACT
CTTACCGAACTTGGCCGTAACCTGCCAACCAAAGCGAGAACAAAACATAACATCAAACGA
ATCGACCGATTGTTAGGTAATCGTCACCTCCACAAAGAGCGACTCGCTGTATACCGTTGG
CATGCTAGCTTTATCTGTTCGGGCAATACGATGCCCATTGTACTTGTTGACTGGTCTGAT
ATCCGTGAGCAAAAACGGCTTATGGTATTGCGAGCTTCAGTCGCACTACACGGTCGTTCT
GTTACTCTTTATGAGAAAGCGTTCCCGCTTTCAGAGCAATGTTCAAAGAAAGCTCATGAC
CAATTTCTAGCCGACCTTGCGAGCATTCTACCGAGTAACACCACACCGCTCATTGTCAGT
GATGCTGGCTTTAAAGTGCCATGGTATAAATCCGTTGAGAAGCTGGGTTGGTACTGGTTA
AGTCGAGTAAGAGGAAAAGTACAATATGCAGACCTAGGAGCGGAAAACTGGAAACCTATC
AGCAACTTACATGATATGTCATCTAGTCACTCAAAGACTTTAGGCTATAAGAGGCTGACT
AAAAGCAATCCAATCTCATGCCAAATTCTATTGTATAAATCTCGCTCTAAAGGCCGAAAA
AATCAGCGCTCGACACGGACTCATTGTCACCACCCGTCACCTAAAATCTACTCAGCGTCG
GCAAAGGAGCCATGGATTCTAGCAACTAACTTACCTGTTGAAATTCGAACACCCAAACAA
CTTGTTAATATCTATTCGAAGCGAATGCAGATTGAAGAAACCTTCCGAGACTTGAAAAGT
CCTGCCTACGGACTAGGCCTACGCCATAGCCGAACGAGCAGCTCAGAGCGTTTTGATATC
ATGCTGCTAATCGCCCTGATGCTTCAACTAACATGTTGGCTTGCGGGCGTTCATGCTCAG
AAACAAGGTTGGGACAAGCACTTCCAGGCTAACACAGTCAGAAATCGAAACGTACTCTCA
ACAGTTCGCTTAGGCATGGAAGTTTTGCGGCATTCTGGCTACACAATAACAAGGGAAGAC
TTACTCGTGGCTGCAACCCTACTAGCTCAAAATTTATTCACACATGGTTACGCTTTGGGG
AAATTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002559 Transposase, IS4-like (Domain)
 [91-328]  2.2e-24 PF01609
PF01609   DDE_Tnp_1
IPR012337 Ribonuclease H-like domain (Domain)
 [1-376]  4.6e-71 SSF53098
SSF53098   Ribonuclease H-like
SignalP No significant hit
TMHMM No significant hit