close all open/close all

CDS information : Lasal2_00070


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction7,375 / 7,788 / + [in whole cluster]
7,375 / 7,788 / + [in contig]
Location7375..7788 [in whole cluster]
7375..7788 [in contig]
TypeCDS
Length414 bp (137 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF07

close this sectionSequence

selected fasta
>
SLKHLSYGKHVSLITDARFSGVSTGACIGHVGPEALAGGPIGKLRTGDLIEIKIDCRELH
GEVNFLGTRSDEQLPSQEEATAILNARPSHQDLLPDPELPDDTRLWAMLQAVSGGTWTGC
IYDVNKIGAALRDFMNKN
selected fasta
>
AGCCTGAAGCATCTGTCATACGGTAAGCATGTTTCGTTAATCACCGATGCACGTTTCTCG
GGCGTTTCTACTGGCGCGTGCATCGGCCATGTGGGGCCAGAAGCGCTGGCCGGAGGCCCC
ATCGGTAAATTACGCACCGGGGATTTAATTGAAATTAAAATTGATTGTCGCGAGCTTCAC
GGCGAAGTCAATTTCCTCGGAACCCGTAGCGATGAACAATTACCTTCACAGGAGGAGGCA
ACTGCAATATTAAATGCCAGACCCAGCCATCAGGATTTACTTCCCGATCCTGAATTGCCA
GATGATACCCGGCTATGGGCAATGCTTCAGGCCGTGAGTGGTGGGACATGGACCGGTTGT
ATTTATGATGTAAACAAAATTGGCGCGGCTTTGCGCGATTTTATGAATAAAAAC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000581 Dihydroxy-acid/6-phosphogluconate dehydratase (Family)
 [2-65]  6.1e-22 PF00920
PF00920   ILVD_EDD
IPR015928 Aconitase/3-isopropylmalate dehydratase, swivel (Domain)
 [4-130]  4.3e-20 SSF52016
SSF52016   LeuD/IlvD-like
IPR020558 Dihydroxy-acid/6-phosphogluconate dehydratase, conserved site (Conserved_site)
 [12-23]  PS00887
PS00887   ILVD_EDD_2
SignalP No significant hit
TMHMM No significant hit