close all open/close all

CDS information : Lasal2_00080


close this sectionLocation

Organism
StrainATCC 31180
Entry nameLasalocid
Contig
Start / Stop / Direction7,898 / 9,088 / + [in whole cluster]
7,898 / 9,088 / + [in contig]
Location7898..9088 [in whole cluster]
7898..9088 [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in lasalocid biosynthesis.
Note (GenBank)
  • ORF08

close this sectionSequence

selected fasta
>
MPLIIVVAGIALLLLLTIKIKLNTFVSLIIVSIAVAIASGMDLSKVVTSVESGLGGTLGH
IGLIFGFGVMLGRLLADAGGAQRIALTMLNYFGKNKLDWAVVCSAFIVGIALFFEVGLIL
LVPILFAIAREAKISPMFMCVPMLSGLLVAHGFLPPHPGPTVIAREYGADVGLVLIYGII
VGIPTFILCGPVLNKFCQRIIPDAFKKEGNIASLGATRRFSESEMPGFGISFLTAMLPVI
LMAVVTIIQMTHAKSAADSGLFYNVILFLGNSTIAMLISLLFAIYTMGLGRGKTIPDLMD
SCGKAIAGIAGLLLIIGGGGAFKQVLIDSGVGQYISTLVSGMDINPILMAWGVAAFLRIC
LGSATVAAISTAGLVIPLLAVHPNTNLALITLATGAG
selected fasta
>
ATGCCACTAATTATCGTTGTGGCAGGGATTGCTTTACTCCTGCTTTTAACCATAAAAATT
AAGCTTAATACGTTTGTTTCGTTAATTATTGTCTCGATTGCTGTCGCCATCGCCAGTGGT
ATGGATTTGAGTAAAGTCGTCACCTCAGTCGAATCCGGACTTGGCGGTACGCTGGGCCAT
ATTGGTTTGATATTTGGCTTCGGTGTTATGCTCGGTCGCTTGCTGGCCGATGCGGGTGGT
GCGCAGCGAATAGCGCTGACCATGCTGAATTATTTCGGGAAAAATAAACTTGACTGGGCA
GTGGTCTGTTCGGCGTTTATTGTCGGTATCGCACTTTTTTTCGAAGTCGGTTTAATTCTT
CTGGTACCTATTTTATTCGCTATTGCCCGTGAAGCAAAAATATCACCGATGTTTATGTGT
GTGCCGATGCTTTCTGGTTTGCTGGTCGCACACGGTTTTTTGCCGCCGCACCCCGGCCCG
ACTGTTATCGCCAGGGAATATGGCGCTGATGTAGGATTGGTACTGATATACGGTATCATT
GTCGGCATTCCAACCTTTATTCTTTGCGGCCCGGTATTGAATAAATTCTGCCAGCGCATT
ATTCCGGACGCCTTTAAAAAAGAGGGGAATATAGCCTCTCTCGGCGCGACCCGCCGATTC
AGCGAAAGCGAAATGCCAGGCTTTGGGATCAGTTTTCTCACGGCAATGCTGCCGGTGATC
CTGATGGCGGTTGTCACCATCATCCAGATGACTCATGCCAAAAGTGCCGCGGATTCAGGC
TTATTTTACAACGTGATACTGTTCTTAGGTAATTCAACGATCGCCATGCTGATTTCACTG
CTATTCGCGATCTATACCATGGGCCTGGGGCGCGGGAAAACAATCCCTGACCTGATGGAT
TCTTGCGGAAAAGCTATCGCGGGTATTGCCGGTCTGCTGCTGATTATCGGTGGTGGTGGT
GCATTCAAGCAAGTTCTCATCGACTCTGGCGTTGGTCAGTATATTTCCACCCTGGTTTCG
GGTATGGATATTAACCCGATCCTGATGGCCTGGGGCGTGGCCGCATTCCTGCGTATTTGT
CTGGGTTCAGCCACCGTCGCGGCGATCTCTACCGCCGGTCTGGTCATCCCATTGTTGGCA
GTACATCCCAATACCAACCTGGCCTTGATTACGCTGGCTACCGGTGCCGGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003474 Gluconate transporter (Family)
 [1-397]  1.9e-157 PF02447
PF02447   GntP_permease
 [1-397]  1.2e-169 TIGR00791
TIGR00791   gntP: transporter, gluconate:H+ symporter (GntP) f
SignalP No significant hit
TMHMM
 [3-20]  Transmembrane (i-o) [25-47]  Transmembrane (o-i) [54-76]  Transmembrane (i-o) [105-127]  Transmembrane (o-i) [134-156]  Transmembrane (i-o) [171-193]  Transmembrane (o-i) [226-248]  Transmembrane (i-o) [263-285]  Transmembrane (o-i) [305-327]  Transmembrane (i-o) [347-369]  Transmembrane (o-i) [374-396]  Transmembrane (i-o)
Transmembrane 11